Protein Description: apoptosis antagonizing transcription factor
Gene Name: AATF
Alternative Gene Name: BFR2, CHE-1, CHE1, DED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018697: 84%, ENSRNOG00000002778: 90%
Entrez Gene ID: 26574
Uniprot ID: Q9NY61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: AATF
Alternative Gene Name: BFR2, CHE-1, CHE1, DED
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018697: 84%, ENSRNOG00000002778: 90%
Entrez Gene ID: 26574
Uniprot ID: Q9NY61
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKG |
Documents & Links for Anti AATF pAb (ATL-HPA075963) | |
Datasheet | Anti AATF pAb (ATL-HPA075963) Datasheet (External Link) |
Vendor Page | Anti AATF pAb (ATL-HPA075963) at Atlas |
Documents & Links for Anti AATF pAb (ATL-HPA075963) | |
Datasheet | Anti AATF pAb (ATL-HPA075963) Datasheet (External Link) |
Vendor Page | Anti AATF pAb (ATL-HPA075963) |