Anti AARSD1 pAb (ATL-HPA023714)

Atlas Antibodies

SKU:
ATL-HPA023714-100
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells of the seminiferus ducts.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: alanyl-tRNA synthetase domain containing 1
Gene Name: AARSD1
Alternative Gene Name: MGC2744
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097239: 91%, ENSRNOG00000020658: 89%
Entrez Gene ID: 80755
Uniprot ID: Q9BTE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGRGLPDDHAGPIRV
Gene Sequence RRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVEQVSGRGLPDDHAGPIRV
Gene ID - Mouse ENSMUSG00000097239
Gene ID - Rat ENSRNOG00000020658
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AARSD1 pAb (ATL-HPA023714)
Datasheet Anti AARSD1 pAb (ATL-HPA023714) Datasheet (External Link)
Vendor Page Anti AARSD1 pAb (ATL-HPA023714) at Atlas Antibodies

Documents & Links for Anti AARSD1 pAb (ATL-HPA023714)
Datasheet Anti AARSD1 pAb (ATL-HPA023714) Datasheet (External Link)
Vendor Page Anti AARSD1 pAb (ATL-HPA023714)