Anti AAR2 pAb (ATL-HPA048645)

Atlas Antibodies

SKU:
ATL-HPA048645-25
  • Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line CACO-2
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: AAR2 splicing factor homolog (S. cerevisiae)
Gene Name: AAR2
Alternative Gene Name: bA234K24.2, C20orf4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027628: 91%, ENSRNOG00000020086: 89%
Entrez Gene ID: 25980
Uniprot ID: Q9Y312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLRE
Gene Sequence LAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLRE
Gene ID - Mouse ENSMUSG00000027628
Gene ID - Rat ENSRNOG00000020086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AAR2 pAb (ATL-HPA048645)
Datasheet Anti AAR2 pAb (ATL-HPA048645) Datasheet (External Link)
Vendor Page Anti AAR2 pAb (ATL-HPA048645) at Atlas Antibodies

Documents & Links for Anti AAR2 pAb (ATL-HPA048645)
Datasheet Anti AAR2 pAb (ATL-HPA048645) Datasheet (External Link)
Vendor Page Anti AAR2 pAb (ATL-HPA048645)