Anti AANAT pAb (ATL-HPA054321)
Atlas Antibodies
- SKU:
- ATL-HPA054321-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AANAT
Alternative Gene Name: SNAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020804: 89%, ENSRNOG00000011182: 89%
Entrez Gene ID: 15
Uniprot ID: Q16613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWR |
Gene Sequence | FLTLCPELSLGWFEEGCLVAFIIGSLWDKERLMQESLTLHRSGGHIAHLHVLAVHRAFRQQGRGPILLWR |
Gene ID - Mouse | ENSMUSG00000020804 |
Gene ID - Rat | ENSRNOG00000011182 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AANAT pAb (ATL-HPA054321) | |
Datasheet | Anti AANAT pAb (ATL-HPA054321) Datasheet (External Link) |
Vendor Page | Anti AANAT pAb (ATL-HPA054321) at Atlas Antibodies |
Documents & Links for Anti AANAT pAb (ATL-HPA054321) | |
Datasheet | Anti AANAT pAb (ATL-HPA054321) Datasheet (External Link) |
Vendor Page | Anti AANAT pAb (ATL-HPA054321) |