Anti AAGAB pAb (ATL-HPA039371)

Atlas Antibodies

SKU: ATL-HPA039371-25

• 

Protein Description: alpha- and gamma-adaptin binding protein
Gene Name: AAGAB
Alternative Gene Name: FLJ11506, p34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037257: 78%, ENSRNOG00000008424: 81%
Entrez Gene ID: 79719
Uniprot ID: Q6PD74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAAD
• Gene Sequence: KAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHPEQPHLPAAD
• Gene ID - Mouse: ENSMUSG00000037257
• Gene ID - Rat: ENSRNOG00000008424
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.