Anti AAED1 pAb (ATL-HPA021294)

Atlas Antibodies

SKU: ATL-HPA021294-25

• 

Protein Description: AhpC/TSA antioxidant enzyme domain containing 1
Gene Name: AAED1
Alternative Gene Name: C9orf21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021482: 93%, ENSRNOG00000018886: 92%
Entrez Gene ID: 195827
Uniprot ID: Q7RTV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
• Gene Sequence: SFLQEANVTLIVIGQSSYHHIEPFCKLTGYSHEIYVDPEREIYKRLGMKRGEEIASSGQ
• Gene ID - Mouse: ENSMUSG00000021482
• Gene ID - Rat: ENSRNOG00000018886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.