Anti AADAT pAb (ATL-HPA037502 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037502-25

• 
• 
• 

Protein Description: aminoadipate aminotransferase
Gene Name: AADAT
Alternative Gene Name: KAT2, KATII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057228: 71%, ENSRNOG00000011861: 71%
Entrez Gene ID: 51166
Uniprot ID: Q8N5Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD
• Gene Sequence: LSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD
• Gene ID - Mouse: ENSMUSG00000057228
• Gene ID - Rat: ENSRNOG00000011861
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.