Anti A1CF pAb (ATL-HPA037779 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037779-25

• 
• 

Protein Description: APOBEC1 complementation factor
Gene Name: A1CF
Alternative Gene Name: ACF, ACF64, ACF65, APOBEC1CF, ASP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052595: 87%, ENSRNOG00000033195: 88%
Entrez Gene ID: 29974
Uniprot ID: Q9NQ94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA
• Gene Sequence: GQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAA
• Gene ID - Mouse: ENSMUSG00000052595
• Gene ID - Rat: ENSRNOG00000033195
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.