Black abstract jellyfish shape

Biomolecules

Cosmo Bio USA delivers a robust, expertly curated portfolio of biomolecules sourced from leading global suppliers, supporting groundbreaking research across molecular biology, lipidomics, immunology, proteomics, and cell biology. Cosmo Bio Co., Ltd. supplies essential reagents including DNA size markers, phage DNA, cDNA libraries, and glycosaminoglycans like chondroitin and heparan sulfates—critical tools for glycobiology and extracellular matrix research. Larodan contributes an extensive selection of ultra-pure lipids, including fatty acids, sterols, glycerides, and phospholipids, trusted for lipidomics, metabolic profiling, and membrane biology studies. CUSABIO strengthens the lineup with a vast catalog of validated recombinant proteins, peptides, and biochemicals, supporting diverse applications in cancer, immunology, infectious disease, and neuroscience. Atlas Antibodies enhance assay development and antibody validation with their unique PrEST antigens, derived from the Human Protein Atlas.

MBL International provides highly specialized biomolecules such as cytokines, chemokines, and growth factors—key tools for dissecting immune responses, inflammation, and signaling pathways. Cellular Engineering Technologies (CET) expands the offering with yeast-derived recombinant human proteins designed for stem cell maintenance, differentiation, and regenerative medicine. Together, these high-quality reagents reflect Cosmo Bio USA’s commitment to advancing discovery by equipping researchers with trusted, application-ready tools. Whether you're exploring cellular pathways, engineering stem cells, or decoding lipid profiles, Cosmo Bio USA delivers the biomolecular solutions to drive innovation and reproducibility across every field of life science and biomedical research.

 

  • DDDDK-tag peptide

    MBL Life Sciences

    DDDDK-tag peptide

    Catalog No.(s): MBL-3325-205

    This synthetic peptide including DDDDK-tag sequence has been designed for the elution of DDDDK-tagged Protein Purification Gel. The peptide sequence is DYKDDDDK. Product Specifications Application IP Molecular Weight 1012...

    $313.00
    Choose Options
  • HA-tag peptide

    MBL Life Sciences

    HA-tag peptide

    Catalog No.(s): MBL-3320-205

    This synthetic peptide including HA-tag sequence has been designed for the elution of HA-tagged Protein Purification Gel. The peptide sequence is YPYDVPDYA. Product Specifications Application IP Molecular Weight 1102...

    $439.00
    Choose Options
  • V5-tag peptide

    MBL Life Sciences

    V5-tag peptide

    Catalog No.(s): MBL-3315-205

    This synthetic peptide including V5-tag sequence has been designed for the elution of V5-tagged Protein Purification Gel. The peptide sequence is GKPIPNPLLGLDST. A complete kit containing this peptide exists for the isolation of V5-tagged protein code #...

    $351.00
    Choose Options
  • His tag peptide

    MBL Life Sciences

    His tag peptide

    Catalog No.(s): MBL-3310-205

    This synthetic peptide including 6xHis tag sequence has been designed for the elution of His tagged Protein PURIFICATION KIT. The peptide sequence is XXX-(6xHis)-XXX. Product Specifications Application IP Molecular Weight 1616...

    $320.00
    Choose Options
  • c-Myc tag peptide (EQKLISEEDL)

    MBL Life Sciences

    c-Myc tag peptide (EQKLISEEDL)

    Catalog No.(s): MBL-3300-205

    c-Myc tag peptide is a synthetic peptide with a molecular weight of 1,203 Da. The peptide sequence is EQKLISEEDL, corresponding to the C-terminal amino acids (410-419) of human c-myc protein. A complete kit containing this peptide exists for the...

    $351.00
    Choose Options
  • Hyaluronan Oligosaccharide 14mer sodium salt

    Cosmo Bio

    Hyaluronan Oligosaccharide 14mer sodium salt

    Catalog No.(s): CSR-11011

    Documents & Links for Hyaluronan Oligosaccharide 14mer sodium salt Datasheet Hyaluronan Oligosaccharide 14mer sodium salt Datasheet Documents & Links for Hyaluronan Oligosaccharide 14mer sodium salt Datasheet Hyaluronan Oligosaccharide...

    $261.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZNF226 (ATL-APrEST96237)

    Catalog No.(s): ATL-APrEST96237

    PrEST Antigen ZNF226, Gene description: zinc finger protein 226, Antigen sequence: QRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGHK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CENPJ (ATL-APrEST96236)

    Catalog No.(s): ATL-APrEST96236

    PrEST Antigen CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4, Antigen sequence:...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZDHHC15 (ATL-APrEST96235)

    Catalog No.(s): ATL-APrEST96235

    PrEST Antigen ZDHHC15, Gene description: zinc finger DHHC-type palmitoyltransferase 15, Alternative Gene Names: DHHC15, FLJ31812, MRX91, Antigen sequence: NEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIK, Storage: Upon delivery store at -20°C. Avoid repeated...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZNF20 (ATL-APrEST96234)

    Catalog No.(s): ATL-APrEST96234

    PrEST Antigen ZNF20, Gene description: zinc finger protein 20, Alternative Gene Names: KOX13, Antigen sequence: SYLDSFQSHDKACTKEKPYDGKECTET, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ARSI (ATL-APrEST96233)

    Catalog No.(s): ATL-APrEST96233

    PrEST Antigen ARSI, Gene description: arylsulfatase family member I, Alternative Gene Names: FLJ16069, SPG66, Antigen sequence: WAKPSFVADGPGEAGEQPSAAPPQPPHIIFILTDDQGYHDVGYHGSDIETPTLDRL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen MCTP1 (ATL-APrEST96232)

    Catalog No.(s): ATL-APrEST96232

    PrEST Antigen MCTP1, Gene description: multiple C2 and transmembrane domain containing 1, Alternative Gene Names: FLJ22344, Antigen sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD, Storage: Upon delivery store at -20°C. Avoid...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CITED2 (ATL-APrEST96231)

    Catalog No.(s): ATL-APrEST96231

    PrEST Antigen CITED2, Gene description: Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 2, Alternative Gene Names: MRG1, Antigen sequence: SGSGNMPASVAHVPAAMLPPNVIDTDFIDEEVLMS, Storage: Upon delivery store at -20°C. Avoid...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen MRPL46 (ATL-APrEST96229)

    Catalog No.(s): ATL-APrEST96229

    PrEST Antigen MRPL46, Gene description: mitochondrial ribosomal protein L46, Alternative Gene Names: C15orf4, LIECG2, P2ECSL, Antigen sequence: AAPSSNGSPWRLLGALCLQRPPVVSKPLTPLQEEMASLLQQIEIERSLYSDHELRALDENQRLAKKKADLHDEEDEQDILL, Storage: Upon delivery...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen TMPRSS11E (ATL-APrEST96228)

    Catalog No.(s): ATL-APrEST96228

    PrEST Antigen TMPRSS11E, Gene description: transmembrane serine protease 11E, Alternative Gene Names: DESC1, TMPRSS11E2, Antigen sequence: NQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLESMVKNAFYKSPLREEFVKSQVIKFSQQKHGV, Storage: Upon delivery store at -20°C...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen SERPINA4 (ATL-APrEST96226)

    Catalog No.(s): ATL-APrEST96226

    PrEST Antigen SERPINA4, Gene description: serpin family A member 4, Alternative Gene Names: KAL, KLST, KST, PI4, Antigen sequence: HGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen TEX264 (ATL-APrEST96222)

    Catalog No.(s): ATL-APrEST96222

    PrEST Antigen TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Antigen sequence: PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL, Storage: Upon delivery store at...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CLDN20 (ATL-APrEST96220)

    Catalog No.(s): ATL-APrEST96220

    PrEST Antigen CLDN20, Gene description: claudin 20, Antigen sequence: WYTKEIIANFLDLTVPESNKHEPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product Specifications Gene...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen NFIC (ATL-APrEST96219)

    Catalog No.(s): ATL-APrEST96219

    PrEST Antigen NFIC, Gene description: nuclear factor I C, Alternative Gene Names: CTF, CTF5, NF-I, NFI, Antigen sequence: QDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen ZNF208 (ATL-APrEST96218)

    Catalog No.(s): ATL-APrEST96218

    PrEST Antigen ZNF208, Gene description: zinc finger protein 208, Alternative Gene Names: PMIDP, ZNF95, Antigen sequence: KVILRRYKIHHHACELGPIMNHHPTCGQMHI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen GPR157 (ATL-APrEST96217)

    Catalog No.(s): ATL-APrEST96217

    PrEST Antigen GPR157, Gene description: G protein-coupled receptor 157, Alternative Gene Names: FLJ12132, Antigen sequence: VRKHINRAHTALSEYRPILSQEHRLLRHSSMADKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen TFDP3 (ATL-APrEST96216)

    Catalog No.(s): ATL-APrEST96216

    PrEST Antigen TFDP3, Gene description: transcription factor Dp family member 3, Alternative Gene Names: CT30, E2F-like, HCA661, Antigen sequence: STVNPLGKQLLPKTFGQSSVNIDQQVVIG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CTNS (ATL-APrEST96215)

    Catalog No.(s): ATL-APrEST96215

    PrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at -20°C. Avoid repeated...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen H3-3B (ATL-APrEST96214)

    Catalog No.(s): ATL-APrEST96214

    PrEST Antigen H3-3B, Gene description: H3.3 histone B, Alternative Gene Names: H3.3B, H3F3B, Antigen sequence: KPHRYRPGTVALREIRRYQKSTELLIR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen WDR46 (ATL-APrEST96212)

    Catalog No.(s): ATL-APrEST96212

    PrEST Antigen WDR46, Gene description: WD repeat domain 46, Alternative Gene Names: BING4, C6orf11, UTP7, Antigen sequence: LSTRTLPHGAGHLAFSQRGLLVAGMGDVVNIWAGQGKASPPSLEQPYLTHRLSGPVHGLQFCPFEDVLGVGHTGGITSMLV, Storage: Upon delivery store at -20°C. Avoid...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen APOOL (ATL-APrEST96210)

    Catalog No.(s): ATL-APrEST96210

    PrEST Antigen APOOL, Gene description: apolipoprotein O like, Alternative Gene Names: AAIR8193, CXorf33, FAM121A, Mic27, MICOS27, UNQ8193, Antigen sequence:...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CCKBR (ATL-APrEST96209)

    Catalog No.(s): ATL-APrEST96209

    PrEST Antigen CCKBR, Gene description: cholecystokinin B receptor, Antigen sequence: FMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen VSX1 (ATL-APrEST96208)

    Catalog No.(s): ATL-APrEST96208

    PrEST Antigen VSX1, Gene description: visual system homeobox 1, Alternative Gene Names: PPCD, PPCD1, PPD, Antigen sequence: RQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRTKRR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen C20orf173 (ATL-APrEST96207)

    Catalog No.(s): ATL-APrEST96207

    PrEST Antigen C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Antigen sequence: VLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQLEMLLRKLSDLVWTSDALSDKILED, Storage: Upon delivery store at -20°C. Avoid repeated...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen SLITRK5 (ATL-APrEST96206)

    Catalog No.(s): ATL-APrEST96206

    PrEST Antigen SLITRK5, Gene description: SLIT and NTRK like family member 5, Alternative Gene Names: bA364G4.2, KIAA0918, LRRC11, Antigen sequence: RESHHLRSPAYSVSTIEPREDLLSPVQDADRFYRGILEPDKHCSTTPAGNSLPEYPKFPCSPAAYTFSPNYDLRRPHQYLHP, Storage: Upon delivery...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen AP1M2 (ATL-APrEST96203)

    Catalog No.(s): ATL-APrEST96203

    PrEST Antigen AP1M2, Gene description: adaptor related protein complex 1 subunit mu 2, Alternative Gene Names: AP1-mu2, HSMU1B, mu2, Antigen sequence: PYFTVSGIQVRYMKIIEKSGYQALPWVRYITQSGDYQLRTS, Storage: Upon delivery store at -20°C. Avoid repeated...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen DPYS (ATL-APrEST96202)

    Catalog No.(s): ATL-APrEST96202

    PrEST Antigen DPYS, Gene description: dihydropyrimidinase, Alternative Gene Names: DHPase, Antigen sequence: THYWKKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNNCQKAL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen COMMD2 (ATL-APrEST96201)

    Catalog No.(s): ATL-APrEST96201

    PrEST Antigen COMMD2, Gene description: COMM domain containing 2, Alternative Gene Names: HSPC042, Antigen sequence: ELSEEHKEHLAFLPQVDSAVVAEFGRIAVEFLRRGANPKIYEGAARKLNVSSDTVQHGVEGLTYLLTESSKLMISELDFQDSV, Storage: Upon delivery store at -20°C. Avoid...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen USP26 (ATL-APrEST96200)

    Catalog No.(s): ATL-APrEST96200

    PrEST Antigen USP26, Gene description: ubiquitin specific peptidase 26, Antigen sequence: VPENPKRKKYVKTSKFVAFDRIINPTKDLYEDKNIRIPERFQKVSEQTQQCDGMRICEQAPQQALPQSFPKPGTQGHTKNLLRP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles...

    $345.00
    Choose Options
  • Atlas Antibodies

    PrEST Antigen CCDC134 (ATL-APrEST96199)

    Catalog No.(s): ATL-APrEST96199

    PrEST Antigen CCDC134, Gene description: coiled-coil domain containing 134, Alternative Gene Names: FLJ22349, Antigen sequence: GISEKDSNFQNPFKIDRTEFIPSTDPFQKALRE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Product...

    $345.00
    Choose Options