Research Area

  • Sodium Keratan Sulfate (Shark Cartilage)

    Cosmo Bio LTD

    Sodium Keratan Sulfate (Shark Cartilage)

    Catalog No.(s): CSR-NAKPS2(SHC)1, CSR-NAKPS2(SHC)3

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

  • Sodium Dermatan Sulfate (Porcine Skin)

    Cosmo Bio LTD

    Sodium Dermatan Sulfate (Porcine Skin)

    Catalog No.(s): CSR-NADS-B2(PGS)3, CSR-NADS-B2(PGS)10

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

    $288.00 - $822.00
    Choose Options
  • Sodium Chondroitin Sulfate E (Squid Cartilage)

    Cosmo Bio LTD

    Sodium Chondroitin Sulfate E (Squid Cartilage)

    Catalog No.(s): CSR-NaCS-E2(SQC)3, CSR-NaCS-E2(SQC)100, CSR-NaCS-E2(SQC)10

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.This product can be used as a non-labeled reference of Fluoresceinamine-labeled Sodium Chondroitin Sulfate E (E1) (Product code: CSR-FACS-E1)...

    $288.00 - $5,745.00
    Choose Options
  • Tear Mucin Assay Kit (O-Glycan assay method)

    Cosmo Bio LTD

    Tear Mucin Assay Kit (O-Glycan assay method)

    Catalog No.(s): CSR-MUC01

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research. Tear Mucin Assay Kit (O-Glycan Assay Method)A kit to extract and fluorometrically determine the amount of mucin content in tearBackgroundMucins...

    $896.00
    Choose Options
  • Glucose Cellular Uptake Measurement Kit (Broad Range, Fluorometric)

    Cosmo Bio LTD

    Glucose Cellular Uptake Measurement Kit (Broad Range, Fluorometric)

    Catalog No.(s): CSR-MBR-PMG-K01

    A complete reagent set to measure 2DG in cells after cell lysis by sonication Insulin is a hormone that lowers the blood glucose level and is known to help glucose enter cells through an effect that enhances the activity of glucose transport, primarily...

    $1,057.00
    Choose Options
  • Amyloid Beta Peptide 42

    Cosmo Bio LTD

    Amyloid Beta Peptide 42

    Catalog No.(s): CSR-KN-TOYU-M04

    Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning:...

    $616.00
    Choose Options
  • Amyloid Beta Peptide 40

    Cosmo Bio LTD

    Amyloid Beta Peptide 40

    Catalog No.(s): CSR-KN-TOYU-M03

    Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning:...

    $448.00
    Choose Options
  • Transthyretin (Met)

    Cosmo Bio LTD

    Transthyretin (Met)

    Catalog No.(s): CSR-KN-TOYU-M02

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

    $280.00
    Choose Options
  • Transthyretin (His-Tag)

    Cosmo Bio LTD

    Transthyretin (His-Tag)

    Catalog No.(s): CSR-KN-TOYU-M01

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

    $280.00
    Choose Options
  • Hyaluronan Quantification Kit

    Cosmo Bio LTD

    Hyaluronan Quantification Kit

    Catalog No.(s): CSR-HA-96KIT

    Hyaluronan (HA) is an unbranched glycosaminoglycan composed of repeating D-glucuronic acid—N-acetyl-D-glucosamine disaccharide subunits. ...

    Hyaluronan Quantification Kit is a highly specific, competitive ELISA kit featuring an HA binding protein optimized to quantify HA polymers larger than 7.4 kDa in samples such as serum, plasma and culture supernatants....

    $718.00
    Choose Options
  • Alkalai-induced liberation of mucin glycan chains from mucin core protein in the presence of 2-cyanoacetamide produces oligosaccharide condensates that fluoresce intensely in borate buffer.

    Cosmo Bio LTD

    Fecal Mucin Assay Kit

    Catalog No.(s): CSR-FFA-MU-K01

    Mucins are a family of heavily glycosylated, high molecular weight (1000-10,000 kDa) proteins rich in threonine, serine and hydroxyproline. ...

    The Fecal Mucin Assay Kit leverages the reducing end of GalNAc sugar chains frequently linked by post-translational O-glycosylation to threonine, serine and hydroxyproline to fluorescently quantitate mucin content in feces....

    $400.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Heparin (N1, Porcine Intestine)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Heparin (N1, Porcine Intestine)

    Catalog No.(s): CSR-FAHEP-N1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Heparan sulfate (HS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of...

    $738.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (T1)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (T1)

    Catalog No.(s): CSR-FAHA-T1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $738.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (S1)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (S1)

    Catalog No.(s): CSR-FAHA-S1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $738.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (M2)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (M2)

    Catalog No.(s): CSR-FAHA-M2

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $615.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (M1)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (M1)

    Catalog No.(s): CSR-FAHA-M1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $738.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (L2)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (L2)

    Catalog No.(s): CSR-FAHA-L2

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $615.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (L1)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (L1)

    Catalog No.(s): CSR-FAHA-L1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $738.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (H2)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (H2)

    Catalog No.(s): CSR-FAHA-H2

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $615.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Hyaluronate (H1)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Hyaluronate (H1)

    Catalog No.(s): CSR-FAHA-H1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Useful for research of chondroitin sulfate Hyaluronan (HA) is a glycosaminoglycan composed of repeating disaccharide units of...

    $738.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Dermatan Sulfate (B1, Porcine Skin)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Dermatan Sulfate (B1, Porcine Skin)

    Catalog No.(s): CSR-FADS-B1(PGS)3

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Dermatan sulfate (DS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of...

    $738.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Chondroitin Poly-Sulfate (P1)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Chondroitin Poly-Sulfate (P1)

    Catalog No.(s): CSR-FACS-P1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Chondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of...

    $677.00
    Choose Options
  • Fluoresceinamine Labeled Sodium Chondroitin Sulfate D (D1, Shark Cartilage)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Chondroitin Sulfate D (D1, Shark Cartilage)

    Catalog No.(s): CSR-FACS-D1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Chondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of...

  • Fluoresceinamine Labeled Sodium Chondroitin Sulfate (C1, Shark Cartilage)

    Cosmo Bio LTD

    Fluoresceinamine Labeled Sodium Chondroitin Sulfate (C1, Shark Cartilage)

    Catalog No.(s): CSR-FACS-C1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for research of chondroitin sulfate Chondroitin sulfate (CS) is a sulfated glycosaminoglycan composed of repeating disaccharide units of...