Systemic Physiology

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

Cosmo Bio LTD

Sesamin, 99% for Analytical standard

Catalog No.(s): CSR-JBM-001

Cosmo Bio LTD

Ribose-Gelatin

Catalog No.(s): CSR-AGE-GP04

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Gelatin (2 mg/ml) was incubated with 30 mM of ribose in a 0.2 M phosphate buffer (pH 7.4) at  37°C for 1 week, followed by dialysis...

Cosmo Bio LTD

Elastin Glycation Assay Kit, Glyceraldehyde

Catalog No.(s): CSR-AAS-AGE-K05

Elastin is one of the extracellular matrix (ECM) proteins with the collagen that consists of many hydrophobic amino acids such as alanine, glycine, valine, and proline. Elastin is the elastic fi brous protein, which located in aorta, ligaments, lung,...

Cosmo Bio LTD

Albumin Glycation Assay Kit, Glyceraldehyde

Catalog No.(s): CSR-AAS-AGE-K01

For rapid detection of fluorescent AGEs and inhibition assay for glycation of albumin solution by glyceraldehyde. The non-enzymatic reaction of reducing carbohydrates with lysine side chains and N-terminal amino groups of macromolecules (proteins,...

CusaBio

Pro-Prostate Specific Antigen (Pro-PSA) ELISA Kit (human)

Catalog No.(s): CSB-ET027786HU-1, CSB-ET027786HU-5, CSB-ET027786HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Pro Interleukin 1 Beta (pro-IL1B) ELISA Kit (mouse)

Catalog No.(s): CSB-ET011614MO-1, CSB-ET011614MO-5, CSB-ET011614MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Testosterone (T) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ028156GU-1, CSB-EQ028156GU-5, CSB-EQ028156GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Midregional pro-Atrial Natriuretic Peptide (MR-proANP) ELISA Kit (human)

Catalog No.(s): CSB-EQ028056HU-1, CSB-EQ028056HU-5, CSB-EQ028056HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Alpha II-spectrin breakdown product SBDP145 ELISA Kit (human)

Catalog No.(s): CSB-EQ028022HU-1, CSB-EQ028022HU-5, CSB-EQ028022HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Platelet-Derived Growth Factor AB (PDGF-AB) ELISA Kit (pig)

Catalog No.(s): CSB-EQ027978PI-1, CSB-EQ027978PI-5, CSB-EQ027978PI-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Lipopolysaccharides (LPS) ELISA Kit (bovine)

Catalog No.(s): CSB-EQ027975BO-1, CSB-EQ027975BO-5, CSB-EQ027975BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (horse)

Catalog No.(s): CSB-EQ027953HO-1, CSB-EQ027953HO-5, CSB-EQ027953HO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ027953GU-1, CSB-EQ027953GU-5, CSB-EQ027953GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (duck)

Catalog No.(s): CSB-EQ027953DU-1, CSB-EQ027953DU-5, CSB-EQ027953DU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

6-hydroxymelatonin sulfate (6HMS) ELISA Kit (human)

Catalog No.(s): CSB-EQ027870HU-1, CSB-EQ027870HU-5, CSB-EQ027870HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Calcitonin Gene Related Peptide (CGRP) ELISA Kit (mouse)

Catalog No.(s): CSB-EQ027706MO-1, CSB-EQ027706MO-5, CSB-EQ027706MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rabbit Creatine Kinase MB Isoenzyme (CK-MB) ELISA Kit

Catalog No.(s): CSB-EQ027653RB-1, CSB-EQ027653RB-5, CSB-EQ027653RB-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Pig Creatine Kinase MB Isoenzyme (CK-MB) ELISA Kit

Catalog No.(s): CSB-EQ027653PI-1, CSB-EQ027653PI-5, CSB-EQ027653PI-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Corticosterone (CORT) ELISA Kit (sheep)

Catalog No.(s): CSB-EQ027629SH-1, CSB-EQ027629SH-5, CSB-EQ027629SH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Corticosterone (CORT) ELISA Kit (goat)

Catalog No.(s): CSB-EQ027629GO-1, CSB-EQ027629GO-5, CSB-EQ027629GO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Adrenocorticotropic hormone (ACTH) ELISA Kit (sheep)

Catalog No.(s): CSB-EQ027618SH-1, CSB-EQ027618SH-5, CSB-EQ027618SH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Angiotensin 1-7 (Ang1-7) ELISA Kit (dog)

Catalog No.(s): CSB-EQ027505DO-1, CSB-EQ027505DO-5, CSB-EQ027505DO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

N-Terminal pro-Brain Natriuretic Peptide (NT-proBNP) ELISA Kit (pig)

Catalog No.(s): CSB-EQ027465PI-1, CSB-EQ027465PI-5, CSB-EQ027465PI-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

5-Hydroxytryptamine/Serotonin (5HT/ST) antibody (IgA) ELISA Kit (human)

Catalog No.(s): CSB-EQ027438HU-1, CSB-EQ027438HU-5, CSB-EQ027438HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Fibrinogen Degradation Product (FDP) ELISA Kit (monkey)

Catalog No.(s): CSB-EQ027418MK-1, CSB-EQ027418MK-5, CSB-EQ027418MK-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (monkey)

Catalog No.(s): CSB-EQ027342MK-1, CSB-EQ027342MK-5, CSB-EQ027342MK-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (horse)

Catalog No.(s): CSB-EQ027342HO-1, CSB-EQ027342HO-5, CSB-EQ027342HO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (chicken)

Catalog No.(s): CSB-EQ027342CH-1, CSB-EQ027342CH-5, CSB-EQ027342CH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit

Catalog No.(s): CSB-EQ027342-1, CSB-EQ027342-5, CSB-EQ027342-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Beta 2 Transferrin (Beta2TF) ELISA Kit (human)

Catalog No.(s): CSB-EQ027323HU-1, CSB-EQ027323HU-5, CSB-EQ027323HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Glucagon-like Peptide 2 (GLP2) ELISA Kit (pig)

Catalog No.(s): CSB-EQ027317PI-1, CSB-EQ027317PI-5, CSB-EQ027317PI-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

C-Peptide ELISA Kit (rabbit)

Catalog No.(s): CSB-EQ027310RB-1, CSB-EQ027310RB-5, CSB-EQ027310RB-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...