Organs & Organ Systems

Cosmo Bio LTD

Amyloid Fluorescent Staining Kit

Catalog No.(s): CSR-SYN02

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageThe Amyloid Fluorescent Staining Kit for histological staining employs a green fluorescent dye that selectively...

Cosmo Bio LTD

Alpha-Synuclein Aggregation Assay Kit

Catalog No.(s): CSR-SYN01

Contains all key reagents needed to promote the formation of aggregates in cultured cells resembling patient aggregates; by the seeded aggregation technique of Nonaka et. al (2010). Sufficient for 400 tests....

Cosmo Bio LTD

CDK5/p25 (active)

Catalog No.(s): CSR-SDT-02-CP25

Visit our Neurodegeneration Products homepage to browse related research productsCDK5 is a member of the Cyclin-Dependent Kinase family that is most abundant in the mammalian brain. This recombinant product is a complex of human Cdk5 and C-terminal...

Cosmo Bio LTD

Sodium Keratan Sulfate (Nasal Cartilage)

Catalog No.(s): CSR-NAKS2(PNC)1, CSR-NAKS2(PNC)3

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

Cosmo Bio LTD

Sodium Keratan Sulfate (Shark Cartilage)

Catalog No.(s): CSR-NAKPS2(SHC)1, CSR-NAKPS2(SHC)3

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

Cosmo Bio LTD

Tear Mucin Assay Kit (O-Glycan assay method)

Catalog No.(s): CSR-MUC01

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research. Tear Mucin Assay Kit (O-Glycan Assay Method)A kit to extract and fluorometrically determine the amount of mucin content in tearBackgroundMucins...

Cosmo Bio LTD

Amyloid Beta Peptide 42

Catalog No.(s): CSR-KN-TOYU-M04

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning:...

Cosmo Bio LTD

Amyloid Beta Peptide 40

Catalog No.(s): CSR-KN-TOYU-M03

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning:...

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

Cosmo Bio LTD

Hyaluronan Quantification Kit

Catalog No.(s): CSR-HA-96KIT

Hyaluronan (HA) is an unbranched glycosaminoglycan composed of repeating D-glucuronic acid—N-acetyl-D-glucosamine disaccharide subunits. ...

Hyaluronan Quantification Kit is a highly specific, competitive ELISA kit featuring an HA binding protein optimized to quantify HA polymers larger than 7.4 kDa in samples such as serum, plasma and culture supernatants....

Cosmo Bio LTD

Fecal Mucin Assay Kit

Catalog No.(s): CSR-FFA-MU-K01

Mucins are a family of heavily glycosylated, high molecular weight (1000-10,000 kDa) proteins rich in threonine, serine and hydroxyproline. ...

The Fecal Mucin Assay Kit leverages the reducing end of GalNAc sugar chains frequently linked by post-translational O-glycosylation to threonine, serine and hydroxyproline to fluorescently quantitate mucin content in feces....

Cosmo Bio LTD

Collagen Quantitation Kit

Catalog No.(s): CSR-COL-001

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Collagen is the one of the main components of extracellular matrix, and accounts for about 30% of the whole human protein. Recentstudies, the...

Cosmo Bio LTD

Bone Resorption Assay FACS

Catalog No.(s): CSR-BRA-FACS1

Bone Resorption Assay FACS is fluoresceinamine-labeled chondroitin sulfate used in Bone Resorption Assay Kits to measure cellular bone resorption activity....

Bone resorption activity releases FACS from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

Cosmo Bio LTD

Bone Resorption Assay Buffer

Catalog No.(s): CSR-BRA-B1

Bone Resorption Assay Buffer is used in Bone Resorption Assay Kits to measure cellular bone resorption activity....

Bone resorption activity releases fluoresceinamine-labeled chondroitin sulfate from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

Cosmo Bio LTD

Bone Resorption Assay Plate

Catalog No.(s): CSR-BRA-24P, CSR-BRA-48P, CSR-BRA-48X2P, CSR-BRA-96P, CSR-BRA-96X2P

Bone Resorption Assay Plates are supplemental calcium phosphate (CaP)-coated multiwell plates (24, 48 or 96 well) used in Bone Resorption Assay Kits to measure cellular bone resorption activity....

Bone resorption activity releases fluoresceinamine-labeled chondroitin sulfate from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

Cosmo Bio LTD

Bone Resorption Assay Kit

Catalog No.(s): CSR-BRA-24KIT, CSR-BRA-48KIT, CSR-BRA-48X2KIT

Bone Resorption Assay Kit is for measurement of cellular bone resorption activity....

Bone resorption activity releases fluoresceinamine-labeled chondroitin sulfate from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

Cosmo Bio LTD

Calcification Evaluation Set

Catalog No.(s): CSR-ARD-SET

This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to extract dye bound to calcified nodules. The optical absorbance of the extracted dye solution is then measured,...

Cosmo Bio LTD

Calcified Nodule Extraction Solution

Catalog No.(s): CSR-ARD-E1

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to...

Cosmo Bio LTD

Alizarin Red Solution

Catalog No.(s): CSR-ARD-A1

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to...

Cosmo Bio LTD

Albumin Glycation Assay Kit, Glyceraldehyde

Catalog No.(s): CSR-AAS-AGE-K01

For rapid detection of fluorescent AGEs and inhibition assay for glycation of albumin solution by glyceraldehyde.The non-enzymatic reaction of reducing carbohydrates with lysine side chains and N-terminal amino groups of macromolecules (proteins,...

Cosmo Bio LTD

Hyaluronan oligosaccharide assortment (HA4, HA6, HA8, HA10, HA12), Endotoxin Free

Catalog No.(s): CSR-93002

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan,...

Cosmo Bio LTD

Hyaluronan oligosaccharide assortment (HA4, HA6, HA8, HA10, HA12)

Catalog No.(s): CSR-93001

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for the research of various activities which high molecular hyaluronic acid does not haveHyaluronic acid is one of glycosaminoglycan,...

Cosmo Bio LTD

Hyaluronan Oligosaccharide 12mer (HA12), Endotoxin Free

Catalog No.(s): CSR-11010

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 10mer (HA10), Endotoxin Free

Catalog No.(s): CSR-11009

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 8mer (HA8), Endotoxin Free

Catalog No.(s): CSR-11008

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 6mer (HA6), Endotoxin Free

Catalog No.(s): CSR-11007

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 4mer (HA4), Endotoxin Free

Catalog No.(s): CSR-11006

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 12mer (HA12)

Catalog No.(s): CSR-11005

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 10mer (HA10)

Catalog No.(s): CSR-11004

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 8mer (HA8)

Catalog No.(s): CSR-11003

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 6mer (HA6)

Catalog No.(s): CSR-11002

Available as standard or endotoxin free as 4-, 6-, 8, 10, and 12-mers or assortment set in standard format or endotoxin free....

Cosmo Bio LTD

Hyaluronan Oligosaccharide 4mer (HA4)

Catalog No.(s): CSR-11001

Available as standard or endotoxin free as 4-,6-, 8, 10, 12-mers or assortment set in standard format or endotoxin free. ...

CusaBio

Pro Interleukin 1 Beta (pro-IL1B) ELISA Kit (mouse)

Catalog No.(s): CSB-ET011614MO-1, CSB-ET011614MO-5, CSB-ET011614MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Testosterone (T) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ028156GU-1, CSB-EQ028156GU-5, CSB-EQ028156GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...