Organs & Organ Systems

  • Amyloid Fluorescent Staining Kit

    Cosmo Bio LTD

    Amyloid Fluorescent Staining Kit

    Catalog No.(s): CSR-SYN02

    Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageThe Amyloid Fluorescent Staining Kit for histological staining employs a green fluorescent dye that selectively...

    $672.00
    Choose Options
  • Alpha-Synuclein Aggregation Assay Kit

    Cosmo Bio LTD

    Alpha-Synuclein Aggregation Assay Kit

    Catalog No.(s): CSR-SYN01

    Contains all key reagents needed to promote the formation of aggregates in cultured cells resembling patient aggregates; by the seeded aggregation technique of Nonaka et. al (2010). Sufficient for 400 tests....

    $736.00
    Choose Options
  • CDK5/p25 (active)

    Cosmo Bio LTD

    CDK5/p25 (active)

    Catalog No.(s): CSR-SDT-02-CP25

    Visit our Neurodegeneration Products homepage to browse related research products CDK5 is a member of the Cyclin-Dependent Kinase family that is most abundant in the mammalian brain. This recombinant product is a complex of human Cdk5 and C-terminal...

    $320.00
    Choose Options
  • Sodium Keratan Sulfate (Nasal Cartilage)

    Cosmo Bio LTD

    Sodium Keratan Sulfate (Nasal Cartilage)

    Catalog No.(s): CSR-NAKS2(PNC)1, CSR-NAKS2(PNC)3

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

  • Sodium Keratan Sulfate (Shark Cartilage)

    Cosmo Bio LTD

    Sodium Keratan Sulfate (Shark Cartilage)

    Catalog No.(s): CSR-NAKPS2(SHC)1, CSR-NAKPS2(SHC)3

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

  • Tear Mucin Assay Kit (O-Glycan assay method)

    Cosmo Bio LTD

    Tear Mucin Assay Kit (O-Glycan assay method)

    Catalog No.(s): CSR-MUC01

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research. Tear Mucin Assay Kit (O-Glycan Assay Method) A kit to extract and fluorometrically determine the amount of mucin content in...

    $896.00
    Choose Options
  • Amyloid Beta Peptide 42

    Cosmo Bio LTD

    Amyloid Beta Peptide 42

    Catalog No.(s): CSR-KN-TOYU-M04

    Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning:...

    $616.00
    Choose Options
  • Amyloid Beta Peptide 40

    Cosmo Bio LTD

    Amyloid Beta Peptide 40

    Catalog No.(s): CSR-KN-TOYU-M03

    Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning:...

    $448.00
    Choose Options
  • Transthyretin (Met)

    Cosmo Bio LTD

    Transthyretin (Met)

    Catalog No.(s): CSR-KN-TOYU-M02

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

    $280.00
    Choose Options
  • Transthyretin (His-Tag)

    Cosmo Bio LTD

    Transthyretin (His-Tag)

    Catalog No.(s): CSR-KN-TOYU-M01

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

    $280.00
    Choose Options
  • Hyaluronan Quantification Kit

    Cosmo Bio LTD

    Hyaluronan Quantification Kit

    Catalog No.(s): CSR-HA-96KIT

    Hyaluronan (HA) is an unbranched glycosaminoglycan composed of repeating D-glucuronic acid—N-acetyl-D-glucosamine disaccharide subunits. ...

    Hyaluronan Quantification Kit is a highly specific, competitive ELISA kit featuring an HA binding protein optimized to quantify HA polymers larger than 7.4 kDa in samples such as serum, plasma and culture supernatants....

    $718.00
    Choose Options
  • Alkalai-induced liberation of mucin glycan chains from mucin core protein in the presence of 2-cyanoacetamide produces oligosaccharide condensates that fluoresce intensely in borate buffer.

    Cosmo Bio LTD

    Fecal Mucin Assay Kit

    Catalog No.(s): CSR-FFA-MU-K01

    Mucins are a family of heavily glycosylated, high molecular weight (1000-10,000 kDa) proteins rich in threonine, serine and hydroxyproline. ...

    The Fecal Mucin Assay Kit leverages the reducing end of GalNAc sugar chains frequently linked by post-translational O-glycosylation to threonine, serine and hydroxyproline to fluorescently quantitate mucin content in feces....

    $400.00
    Choose Options
  • Collagen Quantitation Kit

    Cosmo Bio LTD

    Collagen Quantitation Kit

    Catalog No.(s): CSR-COL-001

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research. Collagen is the one of the main components of extracellular matrix, and accounts for about 30% of the whole human protein. Recentstudies, the...

    $370.00
    Choose Options
  • Bone Resorption Assay FACS

    Cosmo Bio LTD

    Bone Resorption Assay FACS

    Catalog No.(s): CSR-BRA-FACS1

    Bone Resorption Assay FACS is fluoresceinamine-labeled chondroitin sulfate used in Bone Resorption Assay Kits to measure cellular bone resorption activity....

    Bone resorption activity releases FACS from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

    $356.00
    Choose Options
  • Bone Resorption Assay Buffer

    Cosmo Bio LTD

    Bone Resorption Assay Buffer

    Catalog No.(s): CSR-BRA-B1

    Bone Resorption Assay Buffer is used in Bone Resorption Assay Kits to measure cellular bone resorption activity....

    Bone resorption activity releases fluoresceinamine-labeled chondroitin sulfate from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

    $36.00
    Choose Options
  • Bone Resorption Assay Plate

    Cosmo Bio LTD

    Bone Resorption Assay Plate

    Catalog No.(s): CSR-BRA-24P, CSR-BRA-48P, CSR-BRA-48X2P, CSR-BRA-96P, CSR-BRA-96X2P

    Bone Resorption Assay Plates are supplemental calcium phosphate (CaP)-coated multiwell plates (24, 48 or 96 well) used in Bone Resorption Assay Kits to measure cellular bone resorption activity....

    Bone resorption activity releases fluoresceinamine-labeled chondroitin sulfate from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

    $320.00 - $747.00
    Choose Options
  • Bone Resorption Assay Kit

    Cosmo Bio LTD

    Bone Resorption Assay Kit

    Catalog No.(s): CSR-BRA-24KIT, CSR-BRA-48KIT, CSR-BRA-48X2KIT

    Bone Resorption Assay Kit is for measurement of cellular bone resorption activity....

    Bone resorption activity releases fluoresceinamine-labeled chondroitin sulfate from plate-bound calcium phosphate and is quantitated by spectrophotometric evaluation of culture media fluorescence intensity....

    $676.00 - $1,316.00
    Choose Options
  • Calcification Evaluation Set

    Cosmo Bio LTD

    Calcification Evaluation Set

    Catalog No.(s): CSR-ARD-SET

    This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to extract dye bound to calcified nodules. The optical absorbance of the extracted dye solution is then measured,...

    $179.00
    Choose Options
  • Calcified Nodule Extraction Solution

    Cosmo Bio LTD

    Calcified Nodule Extraction Solution

    Catalog No.(s): CSR-ARD-E1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to...

    $89.00
    Choose Options
  • Alizarin Red Solution

    Cosmo Bio LTD

    Alizarin Red Solution

    Catalog No.(s): CSR-ARD-A1

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.This product utilizes Alizarin Red dye solution to stain calcified nodules produced by differentiated osteoblasts, and an acid solution to...

    $133.00
    Choose Options
  • Albumin Glycation Assay Kit, Glyceraldehyde

    Cosmo Bio LTD

    Albumin Glycation Assay Kit, Glyceraldehyde

    Catalog No.(s): CSR-AAS-AGE-K01

    For rapid detection of fluorescent AGEs and inhibition assay for glycation of albumin solution by glyceraldehyde. The non-enzymatic reaction of reducing carbohydrates with lysine side chains and N-terminal amino groups of macromolecules (proteins,...

    $277.00
    Choose Options
  • Hyaluronan oligosaccharide assortment (HA4, HA6, HA8, HA10, HA12)

    Cosmo Bio LTD

    Hyaluronan oligosaccharide assortment (HA4, HA6, HA8, HA10, HA12)

    Catalog No.(s): CSR-93001

    Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.useful for the research of various activities which high molecular hyaluronic acid does not have Hyaluronic acid is one of glycosaminoglycan,...

    $1,401.00
    Choose Options
  • Pro Interleukin 1 Beta (pro-IL1B) ELISA Kit (mouse)

    CusaBio

    Pro Interleukin 1 Beta (pro-IL1B) ELISA Kit (mouse)

    Catalog No.(s): CSB-ET011614MO-1, CSB-ET011614MO-5, CSB-ET011614MO-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $695.00 - $4,937.00
    Choose Options
  • Testosterone (T) ELISA Kit (guinea pig)

    CusaBio

    Testosterone (T) ELISA Kit (guinea pig)

    Catalog No.(s): CSB-EQ028156GU-1, CSB-EQ028156GU-5, CSB-EQ028156GU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $495.00 - $4,087.00
    Choose Options