Visual System

Cosmo Bio LTD

Anti Rhodopsin (Bovine) pAb

Catalog No.(s): LSL-LB-5597

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard Page Product Specifications Application ELISA, IF Reactivity Aquatic & Amphibian, Avian, Bovine, Mouse, Rat,...

Cosmo Bio LTD

Anti Rhodopsin pAb

Catalog No.(s): LSL-LB-5555

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard Page Product Specifications Application ELISA, IF, WB Reactivity Aquatic & Amphibian, Avian, Bovine, Mouse, Rat,...

Cosmo Bio LTD

Anti Rhodopsin (RHO) pAb (Rabbit, Antiserum)

Catalog No.(s): LSL-LB-5533

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard Page Product Specifications Application ELISA, IF, WB Reactivity Drosophila Clonality Polyclonal Host Rabbit

Cosmo Bio LTD

Anti Rhodopsin (Molluscan) pAb

Catalog No.(s): LSL-LB-5509

Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard Page Product Specifications Application ELISA, IF Reactivity Aquatic & Amphibian Clonality Polyclonal Host Rabbit

LABISKOMA

Vascular Endothelial Cell Growth Factor-A (VEGF-A) Equine, ELISA Kit

Catalog No.(s): KBT-K0333016

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Horse VEGF-A ELISA Kit contains...

LABISKOMA

Vascular Endothelial Cell Growth Factor-A (VEGF-A) Bovine, ELISA Kit

Catalog No.(s): KBT-K0333006

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Bovine VEGF-A ELISA Kit...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Rat, ELISA Kit, pink-ONE

Catalog No.(s): KBT-K0331261P

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Rat VEGF ELISA Kit contains all...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Rat, ELISA Kit

Catalog No.(s): KBT-K0331261

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Rat VEGF ELISA Kit contains all...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Mouse, ELISA Kit, pink-ONE

Catalog No.(s): KBT-K0331224P

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Mouse VEGF ELISA Kit contains...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Mouse, ELISA Kit

Catalog No.(s): KBT-K0331224

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Mouse VEGF ELISA Kit contains...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Human, ELISA Kit, pink-ONE

Catalog No.(s): KBT-K0331132P

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Human VEGF ELISA Kit contains...

LABISKOMA

Vascular Endothelial Cell Growth Factor (VEGF) Human, ELISA Kit

Catalog No.(s): KBT-K0331132

Please note that Koma Biotech items have a $300 minimum. Please contact us if you have any questions.Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Description: Human VEGF ELISA Kit contains...

Cosmo Bio LTD

Anti Keratin 12 pAb

Catalog No.(s): KAL-KR074

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Click here to view the KAL dashboard page Product Specifications Application IHC Reactivity Rabbit, Mouse,...

Cosmo Bio LTD

Sodium Keratan Sulfate (Nasal Cartilage)

Catalog No.(s): CSR-NAKS2(PNC)1, CSR-NAKS2(PNC)3

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

Cosmo Bio LTD

Sodium Keratan Sulfate (Shark Cartilage)

Catalog No.(s): CSR-NAKPS2(SHC)1, CSR-NAKPS2(SHC)3

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.

Cosmo Bio LTD

Tear Mucin Assay Kit (O-Glycan assay method)

Catalog No.(s): CSR-MUC01

Click here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research. Tear Mucin Assay Kit (O-Glycan Assay Method) A kit to extract and fluorometrically determine the amount of mucin content in...

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

CusaBio

Mouse Alpha-Enolase (ENO1) Antibody (IgG) ELISA Kit

Catalog No.(s): CSB-EQ027778MO-1, CSB-EQ027778MO-5, CSB-EQ027778MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1) Antibody (IgA) ELISA Kit

Catalog No.(s): CSB-EQ027777HU-1, CSB-EQ027777HU-5, CSB-EQ027777HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1) Antibody (IgM) ELISA Kit

Catalog No.(s): CSB-EQ027776HU-1, CSB-EQ027776HU-5, CSB-EQ027776HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1) Antibody (IgG) ELISA Kit

Catalog No.(s): CSB-EQ027775HU-1, CSB-EQ027775HU-5, CSB-EQ027775HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Vascular Endothelial Growth Factor A (VEGFA) ELISA Kit (bovine)

Catalog No.(s): CSB-EL025833BO-1, CSB-EL025833BO-5, CSB-EL025833BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Bovine Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270BO-1, CSB-EL025270BO-5, CSB-EL025270BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Troponin I, fast skeletal muscle (TNNI2) ELISA Kit

Catalog No.(s): CSB-EL024012HU-1, CSB-EL024012HU-5, CSB-EL024012HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Paired Box 6 (PAX6) ELISA Kit (mouse)

Catalog No.(s): CSB-EL017492MO-1, CSB-EL017492MO-5, CSB-EL017492MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Fatty acid-binding protein 12 (FABP12) ELISA Kit

Catalog No.(s): CSB-EL007941HU-1, CSB-EL007941HU-5, CSB-EL007941HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse Alpha-Enolase (ENO1) ELISA Kit

Catalog No.(s): CSB-EL007670MO-1, CSB-EL007670MO-5, CSB-EL007670MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Decorin (DCN) ELISA Kit (mouse)

Catalog No.(s): CSB-EL006554MO-1, CSB-EL006554MO-5, CSB-EL006554MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Crystallin B Chain (CRYAB) ELISA Kit

Catalog No.(s): CSB-EL006008HU-1, CSB-EL006008HU-5, CSB-EL006008HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rat Alpha-Enolase ELISA Kit

Catalog No.(s): CSB-E17439r-1, CSB-E17439r-5, CSB-E17439r-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Human Alpha-Enolase (ENO1/ENO1L1/MBPB1/MPB1) ELISA Kit

Catalog No.(s): CSB-E17177h-1, CSB-E17177h-5, CSB-E17177h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Decorin/Bone Proteoglycan II (DCN) ELISA Kit (human)

Catalog No.(s): CSB-E16522h-1, CSB-E16522h-5, CSB-E16522h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Vascular Endothelial Cell Growth Factor (VEGF) ELISA Kit (monkey)

Catalog No.(s): CSB-E16502Mk-1, CSB-E16502Mk-5, CSB-E16502Mk-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...