Thyroid

CUSAg

Human Prealbumin

Catalog No.(s): CSB-DP322B

Type: Active AntigenFunction: Liver Function & InjuryApplication: Calibrator, WBPurity: >90% by SDS-PAGELead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage Conditions: Aliquot and store at -20 or...

CUSAg

Human Procalcitonin protein

Catalog No.(s): CSB-DP131D

Type: Active AntigenFunction: InflammationApplication: Calibrator, WBPurity: >90% by SDS-PAGELead Time: 3-20 Working daysStorage Buffer: Supplied in liquid form dissolved in PBS pH 7.4Form: LiquidStorage Conditions: Aliquot and store at -20 or -80  deg C...

CUSAg

Anti Thyroglobulin mAb (CSB-DA263HmN-3)

Catalog No.(s): CSB-DA263HmN-3

Function: Thyroid FunctionPair Information: CSB-DA263HmN-1(capture)-CSB-DA263HmN-3(Detection)Associated Antigen: Purity: Protein G affinity chromat ography, >90 SDS-pageStorage Buffer: MAb solution in 10mM PBS with 15mM NaN3 (PH7.4)Form: LiquidLead Time:...

CUSAg

Anti Thyroglobulin mAb (CSB-DA263HmN-2)

Catalog No.(s): CSB-DA263HmN-2

Function: Thyroid FunctionPair Information: CSB-DA263HmN-1(capture)-CSB-DA263HmN-2(Detection)Associated Antigen: Purity: Protein G affinity chromat ography, >90 SDS-pageStorage Buffer: MAb solution in 10mM PBS with 15mM NaN3 (PH7.4)Form: LiquidLead Time:...

CUSAg

Anti Thyroglobulin mAb (CSB-DA263HmN-1)

Catalog No.(s): CSB-DA263HmN-1

Function: Thyroid FunctionPair Information: CSB-DA263HmN-1(capture)-CSB-DA263HmN-2(Detection)Associated Antigen: Purity: Protein G affinity chromat ography, >90 SDS-pageStorage Buffer: MAb solution in 10mM PBS with 15mM NaN3 (PH7.4)Form: LiquidLead Time:...

CUSAg

Anti Procalcitonin (PCT) mAb (CSB-DA131DmN-6)

Catalog No.(s): CSB-DA131DmN-6

Function: InflamationPair Information: CSB-DA131DmN-3(capture)--CSB-DA131DmN-6(Detection) Associated Antigen: CSB-DP131DPurity: Protein G affinity chromat ography, >90%Storage Buffer: MAb solution in 10mM PBS with 15mM NaN3 (PH7.4)Form: LiquidLead Time:...

CUSAg

Anti Procalcitonin (PCT) mAb (CSB-DA131DmN-5)

Catalog No.(s): CSB-DA131DmN-5

Function: InflamationPair Information: CSB-DA131DmN-3(capture)--CSB-DA131DmN-5(Detection) Associated Antigen: CSB-DP131DPurity: Protein G affinity chromat ography, >90%Storage Buffer: MAb solution in 10mM PBS with 15mM NaN3 (PH7.4)Form: LiquidLead Time:...

CUSAg

Anti Procalcitonin (PCT) mAb (CSB-DA131DmN-4)

Catalog No.(s): CSB-DA131DmN-4

Function: InflamationPair Information: CSB-DA131DmN-3(capture)--CSB-DA131DmN-2(Detection) CSB-DA131DmN-4(capture）- CSB-DA131DmN-2(Detection) Associated Antigen: CSB-DP131DPurity: Protein G affinity chromat ography, >90%Storage...

CUSAg

Anti Procalcitonin (PCT) mAb (CSB-DA131DmN-3)

Catalog No.(s): CSB-DA131DmN-3

Function: InflamationPair Information: CSB-DA131DmN-3(capture)--CSB-DA131DmN-2(Detection) CSB-DA131DmN-4(capture）- CSB-DA131DmN-2(Detection) Associated Antigen: CSB-DP131DPurity: Protein G affinity chromat ography, >90%Storage...

CUSAg

Anti Procalcitonin (PCT) mAb (CSB-DA131DmN-2)

Catalog No.(s): CSB-DA131DmN-2

Function: InflamationPair Information: CSB-DA131DmN-3(capture)--CSB-DA131DmN-2(Detection) CSB-DA131DmN-4(capture）- CSB-DA131DmN-2(Detection) Associated Antigen: CSB-DP131DPurity: Protein G affinity chromat ography, >90%Storage...

CUSAg

Anti Procalcitonin (PCT) mAb (CSB-DA131DmN-1)

Catalog No.(s): CSB-DA131DmN-1

Function: InflamationPair Information: CSB-DA131DmN-3(capture)--CSB-DA131DmN-2(Detection) CSB-DA131DmN-4(capture）- CSB-DA131DmN-2(Detection) Associated Antigen: CSB-DP131DPurity: Protein G affinity chromat ography, >90%Storage...

CusaBio

Thyrotropin subunit beta (TSHB) N-terminal 6xHis-tagged and C-terminal Myc-tagged (yeast-derived, recombinant rat)

Catalog No.(s): CSB-YP025130RA-20, CSB-YP025130RA-100, CSB-YP025130RA-500

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Calcitonin (CALCA) N-terminal 6xHis-tagged (yeast-derived, recombinant human)

Catalog No.(s): CSB-YP004434HU(A7)-20, CSB-YP004434HU(A7)-100

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Calcitonin Gene-related Peptide 1 (CALCA) partial, N-terminal GST-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-RP153444h-20, CSB-RP153444h-100, CSB-RP153444h-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Thyrotropin subunit beta (TSHB) N-terminal 10xHis-tagged and C-terminal Myc-tagged (E. coli-derived, recombinant rat)

Catalog No.(s): CSB-EP025130RA-20, CSB-EP025130RA-100, CSB-EP025130RA-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Thyrotropin subunit beta (TSHB) N-terminal 6xHis-SUMO-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-EP025130HU-20, CSB-EP025130HU-100, CSB-EP025130HU-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Thyrotropin subunit beta (TSHB) N-terminal 10xHis-tagged (E. coli-derived, recombinant dog)

Catalog No.(s): CSB-EP025130DO-20, CSB-EP025130DO-100, CSB-EP025130DO-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Calcitonin Gene-related Peptide 2 (CALCB) N-terminal GST-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-EP004435HU-20, CSB-EP004435HU-100, CSB-EP004435HU-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Calcitonin (CALCA) N-terminal 6xHis-SUMO-tagged (E. coli-derived, recombinant dog)

Catalog No.(s): CSB-EP004434DO-20, CSB-EP004434DO-100, CSB-EP004434DO-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Thyrotropin subunit beta (TSHB) N-terminal 10xHis-tagged and C-terminal Myc-tagged (Baculovirus-derived, recombinant rat)

Catalog No.(s): CSB-BP025130RA-20, CSB-BP025130RA-100, CSB-BP025130RA-500

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

Cosmo Bio LTD

Anti Thyroid Stimulating Hormone Subunit Beta (TSHB) mAb (Clone 9G11)

Catalog No.(s): LNM-KR-047

Product Specifications Application ELISA Reactivity Human Clonality Monoclonal (Clone No.: 9G11) Host Mouse

Cosmo Bio LTD

Anti Thyroid Stimulating Hormone Subunit Beta (TSHB) mAb (Clone 3F10)

Catalog No.(s): LNM-KR-046

Product Specifications Application ELISA Reactivity Human Clonality Monoclonal (Clone No.: 3F10) Host Mouse

Cosmo Bio LTD

Anti Thyroglobulin mAb (Clone 7C8)

Catalog No.(s): LNM-KR-041

Product Specifications Application ELISA Reactivity Human Clonality Monoclonal (Clone No.: 7C8) Host Mouse

Cosmo Bio LTD

Anti Thyroglobulin mAb (Clone 19B7)

Catalog No.(s): LNM-KR-040

Product Specifications Application ELISA Reactivity Human Clonality Monoclonal (Clone No.: 19B7) Host Mouse

Cosmo Bio LTD

Anti Zmat4 pAb

Catalog No.(s): KAL-KG407

Click here to view the KAL dashboard page Product Specifications Application IHC(p) Reactivity Mouse Clonality Polyclonal Host Rabbit

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

CusaBio

Mouse Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Bovine Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270BO-1, CSB-EL025270BO-5, CSB-EL025270BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Canine Procalcitonin (PCT) ELISA Kit

Catalog No.(s): CSB-E17400c-1, CSB-E17400c-5, CSB-E17400c-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Pig Procalcitonin,PCT ELISA Kit

Catalog No.(s): CSB-E15004p-1, CSB-E15004p-5, CSB-E15004p-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Bovine procalcitonin (PCT) ELISA kit

Catalog No.(s): CSB-E15004B-1, CSB-E15004B-5, CSB-E15004B-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rat procalcitonin (PCT) ELISA kit

Catalog No.(s): CSB-E13419r-1, CSB-E13419r-5, CSB-E13419r-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Canine prealbumin (PA) ELISA Kit

Catalog No.(s): CSB-E13252c-1, CSB-E13252c-5, CSB-E13252c-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Rat Prealbumin (PA) ELISA Kit

Catalog No.(s): CSB-E13251r-1, CSB-E13251r-5, CSB-E13251r-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...