Neurobiology

Cosmo Bio LTD

Anti Opioid Receptor Delta 1 (OPRD1/DOR) mAb (Clone 1E7)

Catalog No.(s): KAL-KG142

Click here to view the KAL dashboard page Product Specifications Application FC, ICC, IF, WB Reactivity Human Clonality Monoclonal (Clone No.: 1E7) Host Mouse

Cosmo Bio LTD

Anti Opioid Receptor Kappa 1 (OPRK1/KOR) mAb (Clone 5E3)

Catalog No.(s): KAL-KG139

Click here to view the KAL dashboard page Product Specifications Application FC, ICC, IF, WB Reactivity Human Clonality Monoclonal (Clone No.: 5E3) Host Mouse

Cosmo Bio LTD

Anti Metallothionein mAb (Clone 1A12, Biotin Labeled)

Catalog No.(s): KAL-KA009-01

Click here to view the KAL dashboard page Metallothinein(MT), a cysteine-rich(30%), metal-binding protein, exists in most tissues and is easily induced by many stimuli. It’s multifunction roles in the body have been proposed such as a chelator to...

Cosmo Bio LTD

Anti Metallothionein mAb (Clone 1A12)

Catalog No.(s): KAL-KA009

Click here to view the KAL dashboard page Metallothinein(MT), a cysteine-rich(30%), metal-binding protein, exists in most tissues and is easily induced by many stimuli. It’s multifunction roles in the body have been proposed such as a chelator to...

4BioDx

Anti-APP [pT668] pAb

Catalog No.(s): BDX-4BDX-1503S, BDX-4BDX-1503

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageRabbit polyclonal antibody pT668 recognizes the phosphorylated threonine 668 of Amyloid Protein Precursor (APP) and is...

4BioDx

Anti-Tau [pS199] pAb

Catalog No.(s): BDX-4BDX-1502S, BDX-4BDX-1502

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageRabbit polyclonal antibody pS199 recognizes the phosphorylated serine 199 of Tau proteins and is suitable for Western...

4BioDx

Anti-Tau mAb [pS422] (clone 2H9)

Catalog No.(s): BDX-4BDX-1501, BDX-4BDX-1501S

Visit our Neurodegeneration Products homepage to browse related research productsClick here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Click here for the Neuroscience Products Dashboard PageMouse...

Cosmo Bio LTD

Alpha-Synuclein, Recombinant, Human

Catalog No.(s): CSR-SYN04-2, CSR-SYN04-1

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageE. coli expressed human α-synuclein has been widely used in structural and functional studies. Masuda et. al...

Cosmo Bio LTD

Alpha-Synuclein Fibrils, Human

Catalog No.(s): CSR-SYN03

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Pageα-Synuclein Fibrils, Human This product is sonicated, preformed human α-synuclein fibrils confirmed to...

Cosmo Bio LTD

Amyloid Fluorescent Staining Kit

Catalog No.(s): CSR-SYN02

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageThe Amyloid Fluorescent Staining Kit for histological staining employs a green fluorescent dye that selectively...

Cosmo Bio LTD

Alpha-Synuclein Aggregation Assay Kit

Catalog No.(s): CSR-SYN01

Contains all key reagents needed to promote the formation of aggregates in cultured cells resembling patient aggregates; by the seeded aggregation technique of Nonaka et. al (2010). Sufficient for 400 tests....

Cosmo Bio LTD

CDK5/p25 (active)

Catalog No.(s): CSR-SDT-02-CP25

Visit our Neurodegeneration Products homepage to browse related research products CDK5 is a member of the Cyclin-Dependent Kinase family that is most abundant in the mammalian brain. This recombinant product is a complex of human Cdk5 and C-terminal...

Cosmo Bio LTD

Amyloid Beta Peptide 42

Catalog No.(s): CSR-KN-TOYU-M04

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning:...

Cosmo Bio LTD

Amyloid Beta Peptide 40

Catalog No.(s): CSR-KN-TOYU-M03

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning:...

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

CusaBio

Pro Interleukin 1 Beta (pro-IL1B) ELISA Kit (mouse)

Catalog No.(s): CSB-ET011614MO-1, CSB-ET011614MO-5, CSB-ET011614MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Testosterone (T) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ028156GU-1, CSB-EQ028156GU-5, CSB-EQ028156GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Midregional pro-Atrial Natriuretic Peptide (MR-proANP) ELISA Kit (human)

Catalog No.(s): CSB-EQ028056HU-1, CSB-EQ028056HU-5, CSB-EQ028056HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Alpha II-spectrin breakdown product SBDP145 ELISA Kit (human)

Catalog No.(s): CSB-EQ028022HU-1, CSB-EQ028022HU-5, CSB-EQ028022HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (horse)

Catalog No.(s): CSB-EQ027953HO-1, CSB-EQ027953HO-5, CSB-EQ027953HO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ027953GU-1, CSB-EQ027953GU-5, CSB-EQ027953GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (duck)

Catalog No.(s): CSB-EQ027953DU-1, CSB-EQ027953DU-5, CSB-EQ027953DU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

6-hydroxymelatonin sulfate (6HMS) ELISA Kit (human)

Catalog No.(s): CSB-EQ027870HU-1, CSB-EQ027870HU-5, CSB-EQ027870HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Alzheimer-associated neuronal thread protein (AD7C-NTP) ELISA Kit (human)

Catalog No.(s): CSB-EQ027774HU-1, CSB-EQ027774HU-5, CSB-EQ027774HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Calcitonin Gene Related Peptide (CGRP) ELISA Kit (mouse)

Catalog No.(s): CSB-EQ027706MO-1, CSB-EQ027706MO-5, CSB-EQ027706MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Corticosterone (CORT) ELISA Kit (sheep)

Catalog No.(s): CSB-EQ027629SH-1, CSB-EQ027629SH-5, CSB-EQ027629SH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Corticosterone (CORT) ELISA Kit (goat)

Catalog No.(s): CSB-EQ027629GO-1, CSB-EQ027629GO-5, CSB-EQ027629GO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Adrenocorticotropic hormone (ACTH) ELISA Kit (sheep)

Catalog No.(s): CSB-EQ027618SH-1, CSB-EQ027618SH-5, CSB-EQ027618SH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Angiotensin 1-7 (Ang1-7) ELISA Kit (dog)

Catalog No.(s): CSB-EQ027505DO-1, CSB-EQ027505DO-5, CSB-EQ027505DO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

N-Terminal pro-Brain Natriuretic Peptide (NT-proBNP) ELISA Kit (pig)

Catalog No.(s): CSB-EQ027465PI-1, CSB-EQ027465PI-5, CSB-EQ027465PI-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

5-Hydroxytryptamine/Serotonin (5HT/ST) antibody (IgA) ELISA Kit (human)

Catalog No.(s): CSB-EQ027438HU-1, CSB-EQ027438HU-5, CSB-EQ027438HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (monkey)

Catalog No.(s): CSB-EQ027342MK-1, CSB-EQ027342MK-5, CSB-EQ027342MK-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (horse)

Catalog No.(s): CSB-EQ027342HO-1, CSB-EQ027342HO-5, CSB-EQ027342HO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...