Neurobiology

Cosmo Bio LTD

Anti Humanin S14G pAb (Rabbit, Affinity Purified)

Catalog No.(s): KAL-KR061

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Human  Humanin (HN) is a new...

Cosmo Bio LTD

Anti ADP Ribosylation Factor Like GTPase 6 Interacting Protein 5 (ARL6IP5/Addicsin) pAb (Rabbit, Affinity Purified)

Catalog No.(s): KAL-KR057

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: IHC, WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

Cosmo Bio LTD

Anti Humanin pAb (Rabbit, Purified)

Catalog No.(s): KAL-KR050

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Human 

Cosmo Bio LTD

Anti Semaphorin 4B (SEMA4B) mAb (Clone TK-2)

Catalog No.(s): KAL-KO599

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: FC, IP, ELISA Clonality: Monoclonal Host: Rat Purification: IgM Reactivity: Mouse 

Cosmo Bio LTD

Anti TRPC5 pAb

Catalog No.(s): KAL-KO459

Click here to view the KAL dashboard pageApplication: ELISA Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

Cosmo Bio LTD

Anti TRPC5 pAb (cross-reactive to bovine)

Catalog No.(s): KAL-KO458

Click here to view the KAL dashboard pageApplication: ELISA, WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Bovine, Mouse 

Cosmo Bio LTD

Anti Calcium Voltage-Gated Channel Auxiliary Subunit Beta 4 (CACNB4) C-terminal region pAb (Rabbit, Affinity Purified)

Catalog No.(s): KAL-KO455

Click here to view the KAL dashboard pageApplication: IP, ICC, ELISA, WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

Cosmo Bio LTD

Anti Regulating Synaptic Membrane Exocytosis 1 (RIMS1) pAb (Rabbit, Affinity Purified)

Catalog No.(s): KAL-KO454

Click here to view the KAL dashboard pageApplication: IP, ELISA, WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

Cosmo Bio LTD

Anti Semaphorin 4D (SEMA4D) mAb (Clone SK-3)

Catalog No.(s): KAL-KO453

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: FC, IP, ELISA Clonality: Monoclonal Host: Mouse Purification: Ig-PG Reactivity: Mouse, Human 

Cosmo Bio LTD

Anti Semaphorin 7A (SEMA7A) mAb (Clone SKK-7)

Catalog No.(s): KAL-KO402

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: FC, IP, ELISA Clonality: Monoclonal Host: Mouse Purification: Ig-PG Reactivity: Mouse, Human 

Cosmo Bio LTD

Anti Semaphorin 4A (SEMA4A) mAb (Clone HIAT-2)

Catalog No.(s): KAL-KO401

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: FC, IP, ELISA Clonality: Monoclonal Host: Mouse Purification: Ig-PG Reactivity: Mouse, Human 

Cosmo Bio LTD

Anti TRPA1 pAb

Catalog No.(s): KAL-KM120

Click here to view the KAL dashboard pageApplication: IP, WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

Cosmo Bio LTD

Anti DIX Domain Containing 1 (DIXDC1/CCD1) pAb (Rabbit, Affinity Purified)

Catalog No.(s): KAL-KM107

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: ICC, WB Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Aquatic & Amphibian 

Cosmo Bio LTD

Anti TRPV2 / VRL-1 pAb

Catalog No.(s): KAL-KM019

Click here to view the KAL dashboard pageApplication: IHC Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Rat 

Cosmo Bio LTD

Anti Calnexin mAb (Clone 2E9)

Catalog No.(s): KAL-KK054

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: WB Clonality: Monoclonal Host: Mouse Purification: Purified - Affinity Reactivity: Human  Immature and new...

Cosmo Bio LTD

Anti Haao pAb

Catalog No.(s): KAL-KG408

Click here to view the KAL dashboard pageClick here for the Neuroscience Products Dashboard Page.Application: IHC(p) Clonality: Polyclonal Host: Rabbit Purification: Purified - Affinity Reactivity: Mouse 

Cosmo Bio LTD

Anti Opioid Receptor Delta 1 (OPRD1/DOR) mAb (Clone 1E7)

Catalog No.(s): KAL-KG142

Click here to view the KAL dashboard pageApplication: FC, ICC, IF, WB Clonality: Monoclonal Host: Mouse Purification: Ig-PG Reactivity: Human 

Cosmo Bio LTD

Anti Opioid Receptor Kappa 1 (OPRK1/KOR) mAb (Clone 5E3)

Catalog No.(s): KAL-KG139

Click here to view the KAL dashboard pageApplication: FC, ICC, IF, WB Clonality: Monoclonal Host: Mouse Purification: Ig-PG Reactivity: Human 

Cosmo Bio LTD

Anti Metallothionein mAb (Clone 1A12, Biotin Labeled)

Catalog No.(s): KAL-KA009-01

Click here to view the KAL dashboard pageApplication: WB Clonality: Monoclonal Conjugation: Biotin Host: Mouse Purification: Purified - Affinity Reactivity: Rabbit, Mouse, Rat, Human Metallothinein(MT), a...

Cosmo Bio LTD

Anti Metallothionein mAb (Clone 1A12)

Catalog No.(s): KAL-KA009

Click here to view the KAL dashboard pageApplication: WB Clonality: Monoclonal Host: Mouse Purification: Purified - Affinity Reactivity: Rabbit, Mouse, Rat, Human Metallothinein(MT), a cysteine-rich(30%), metal-binding...

4BioDx

Anti-APP [pT668] pAb

Catalog No.(s): BDX-4BDX-1503S, BDX-4BDX-1503

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageApplication: IHC, IF, WB Clonality: Polyclonal Host: Rabbit Reactivity: Rat, Mouse, Human Rabbit...

4BioDx

Anti-Tau [pS199] pAb

Catalog No.(s): BDX-4BDX-1502S, BDX-4BDX-1502

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageApplication: IHC, IF, WB Clonality: Polyclonal Host: Rabbit Reactivity: Rat, Mouse, Human Rabbit...

4BioDx

Anti-Tau mAb [pS422] (clone 2H9)

Catalog No.(s): BDX-4BDX-1501, BDX-4BDX-1501S

Visit our Neurodegeneration Products homepage to browse related research productsClick here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Click here for the Neuroscience Products Dashboard...

Cosmo Bio LTD

Alpha-Synuclein, Recombinant, Human

Catalog No.(s): CSR-SYN04-2, CSR-SYN04-1

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageE. coli expressed human α-synuclein has been widely used in structural and functional studies. Masuda et. al...

Cosmo Bio LTD

Alpha-Synuclein Fibrils, Human

Catalog No.(s): CSR-SYN03

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Pageα-Synuclein Fibrils, HumanThis product is sonicated, preformed human α-synuclein fibrils confirmed to...

Cosmo Bio LTD

Amyloid Fluorescent Staining Kit

Catalog No.(s): CSR-SYN02

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageThe Amyloid Fluorescent Staining Kit for histological staining employs a green fluorescent dye that selectively...

Cosmo Bio LTD

Alpha-Synuclein Aggregation Assay Kit

Catalog No.(s): CSR-SYN01

Contains all key reagents needed to promote the formation of aggregates in cultured cells resembling patient aggregates; by the seeded aggregation technique of Nonaka et. al (2010). Sufficient for 400 tests....

Cosmo Bio LTD

CDK5/p25 (active)

Catalog No.(s): CSR-SDT-02-CP25

Visit our Neurodegeneration Products homepage to browse related research productsCDK5 is a member of the Cyclin-Dependent Kinase family that is most abundant in the mammalian brain. This recombinant product is a complex of human Cdk5 and C-terminal...

Cosmo Bio LTD

Amyloid Beta Peptide 42

Catalog No.(s): CSR-KN-TOYU-M04

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning:...

Cosmo Bio LTD

Amyloid Beta Peptide 40

Catalog No.(s): CSR-KN-TOYU-M03

Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning:...

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

CusaBio

Pro Interleukin 1 Beta (pro-IL1B) ELISA Kit (mouse)

Catalog No.(s): CSB-ET011614MO-1, CSB-ET011614MO-5, CSB-ET011614MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Testosterone (T) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ028156GU-1, CSB-EQ028156GU-5, CSB-EQ028156GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Midregional pro-Atrial Natriuretic Peptide (MR-proANP) ELISA Kit (human)

Catalog No.(s): CSB-EQ028056HU-1, CSB-EQ028056HU-5, CSB-EQ028056HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...