Cosmo Bio LTD Anti Mitofusin 2 (MFN2) pAb (Rabbit, Antiserum) Catalog No.(s): PRX-MKA0214 About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $353.00 Choose Options
Cosmo Bio LTD Anti WASH Complex Subunit 5 (WASHC5) pAb (Rabbit, Purified Ig) Catalog No.(s): PRX-MKA0196PA About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $589.00 Choose Options
Cosmo Bio LTD Anti WASH Complex Subunit 5 (WASHC5) pAb (Rabbit, Antiserum) Catalog No.(s): PRX-MKA0196 About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $353.00 Choose Options
Cosmo Bio LTD Anti Pumilio RNA Binding Family Member 1 (PUM1) pAb (Rabbit, Purified Ig) Catalog No.(s): PRX-MKA0099PA About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $589.00 Choose Options
Cosmo Bio LTD Anti Pumilio RNA Binding Family Member 1 (PUM1) pAb (Rabbit, Antiserum) Catalog No.(s): PRX-MKA0099 About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $353.00 Choose Options
Cosmo Bio LTD Anti Lysyl-TRNA Synthetase (KARS) pAb (Rabbit, Purified Ig) Catalog No.(s): PRX-MKA0070PA About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $589.00 Choose Options
Cosmo Bio LTD Anti Lysyl-TRNA Synthetase (KARS) pAb (Rabbit, Antiserum) Catalog No.(s): PRX-MKA0070 About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $353.00 Choose Options
Cosmo Bio LTD Anti Synaptojanin 1 (SYNJ1) pAb (Rabbit, Affinity Purified) Catalog No.(s): PRX-MK09100910 About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $589.00 Choose Options
Cosmo Bio LTD Anti Optineurin (OPTN) pAb (Rabbit, Antiserum) Catalog No.(s): PRX-KB9422GNP About this maker: This item is a product of ProteinExpress Co. Ltd (Chiba, Japan), an R&D company expert cell-free protein synthesis and large scale cellular protein expression. See all ProteinExpress products at the ProteinExpress dashboard page... MSRP: Was: Now: $353.00 Choose Options
Cosmo Bio LTD Anti 4-Hydroxynonenal (HNE) mAb (Clone HNEJ-2) Catalog No.(s): NNS-MHN-020P-EX, NNS-MHN-100P-EX Product Specifications Application IHC, WB Clonality Monoclonal (Clone No.: HNEJ-2) Host Mouse MSRP: Was: Now: $271.00 - $1,056.00 Choose Options
Cosmo Bio LTD Anti GM3 mAb (Clone M2590) Catalog No.(s): NBT-M102 Previous catalog number NBT-M102... MSRP: Was: Now: $1,676.00 Choose Options
Cosmo Bio LTD Anti Prion Protein B pAb Catalog No.(s): LSL-LB-3227 Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard Page Product Specifications Application ELISA, IF, WB Reactivity Farm Animal - Other, Bovine, Mouse, Rat,... MSRP: Was: Now: $621.00 Choose Options
Cosmo Bio LTD Anti Prion Protein A pAb Catalog No.(s): LSL-LB-3117 Click here for more Allergen-related productsClick here for the Neuroscience Products Dashboard Page Product Specifications Application ELISA, IF, WB Reactivity Farm Animal - Other, Bovine, Mouse, Rat,... MSRP: Was: Now: $621.00 Choose Options
Cosmo Bio LTD Anti Estradiol 17-Beta-Dehydrogenase 8 (HSD17B8) pAb (Rabbit, Affinity Purified) Catalog No.(s): KAL-KR099 Click here to view the KAL dashboard page Product Specifications Application IHC Reactivity Human Clonality Polyclonal Host Rabbit MSRP: Was: Now: $786.00 Choose Options
Cosmo Bio LTD Anti Tau, phospho Ser416 pAb Catalog No.(s): KAL-KR076 Rabbit Polyclonal: 2X epitope affinity purified. First vs cognate phospho-peptide then vs cognate non-phosphorylated peptide. ... MSRP: Was: Now: $786.00 Choose Options
4BioDx Anti-APP [pT668] pAb Catalog No.(s): BDX-4BDX-1503S, BDX-4BDX-1503 Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageRabbit polyclonal antibody pT668 recognizes the phosphorylated threonine 668 of Amyloid Protein Precursor (APP) and is... MSRP: Was: Now: $169.00 - $282.00 Choose Options
4BioDx Anti-Tau [pS199] pAb Catalog No.(s): BDX-4BDX-1502S, BDX-4BDX-1502 Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageRabbit polyclonal antibody pS199 recognizes the phosphorylated serine 199 of Tau proteins and is suitable for Western... MSRP: Was: Now: $169.00 - $282.00 Choose Options
4BioDx Anti-Tau mAb [pS422] (clone 2H9) Catalog No.(s): BDX-4BDX-1501, BDX-4BDX-1501S Visit our Neurodegeneration Products homepage to browse related research productsClick here to browse a well organized list of products for Bone, Collagen, and Extracellular Matrix research.Click here for the Neuroscience Products Dashboard PageMouse... MSRP: Was: Now: $214.00 - $339.00 Choose Options
Cosmo Bio LTD Alpha-Synuclein, Recombinant, Human Catalog No.(s): CSR-SYN04-2, CSR-SYN04-1 Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageE. coli expressed human α-synuclein has been widely used in structural and functional studies. Masuda et. al... MSRP: Was: Now: $270.00 - $810.00 Choose Options
Cosmo Bio LTD Alpha-Synuclein Fibrils, Human Catalog No.(s): CSR-SYN03 Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Pageα-Synuclein Fibrils, Human This product is sonicated, preformed human α-synuclein fibrils confirmed to... MSRP: Was: Now: $900.00 Choose Options
Cosmo Bio LTD Amyloid Fluorescent Staining Kit Catalog No.(s): CSR-SYN02 Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard PageThe Amyloid Fluorescent Staining Kit for histological staining employs a green fluorescent dye that selectively... MSRP: Was: Now: $360.00 Choose Options
Cosmo Bio LTD Alpha-Synuclein Aggregation Assay Kit Catalog No.(s): CSR-SYN01 Contains all key reagents needed to promote the formation of aggregates in cultured cells resembling patient aggregates; by the seeded aggregation technique of Nonaka et. al (2010). Sufficient for 400 tests.... MSRP: Was: Now: $828.00 Choose Options
Cosmo Bio LTD Amyloid Beta Peptide 42 Catalog No.(s): CSR-KN-TOYU-M04 Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAWarning:... MSRP: Was: Now: $647.00 Choose Options
Cosmo Bio LTD Amyloid Beta Peptide 40 Catalog No.(s): CSR-KN-TOYU-M03 Visit our Neurodegeneration Products homepage to browse related research productsClick here for the Neuroscience Products Dashboard Page Recombinant Protein / Amyloid beta peptide 40 (A Beta40)Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVWarning:... MSRP: Was: Now: $470.00 Choose Options
Cosmo Bio LTD Transthyretin (Met) Catalog No.(s): CSR-KN-TOYU-M02 Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store... MSRP: Was: Now: $294.00 Choose Options
Cosmo Bio LTD Transthyretin (His-Tag) Catalog No.(s): CSR-KN-TOYU-M01 Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA... MSRP: Was: Now: $294.00 Choose Options
CusaBio Alpha II-spectrin breakdown product SBDP145 ELISA Kit (human) Catalog No.(s): CSB-EQ028022HU-1, CSB-EQ028022HU-5, CSB-EQ028022HU-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $730.00 - $5,184.00 Choose Options
CusaBio Estradiol (E2) ELISA Kit (horse) Catalog No.(s): CSB-EQ027953HO-1, CSB-EQ027953HO-5, CSB-EQ027953HO-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $520.00 - $4,291.00 Choose Options
CusaBio Estradiol (E2) ELISA Kit (guinea pig) Catalog No.(s): CSB-EQ027953GU-1, CSB-EQ027953GU-5, CSB-EQ027953GU-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $520.00 - $4,291.00 Choose Options
CusaBio Estradiol (E2) ELISA Kit (duck) Catalog No.(s): CSB-EQ027953DU-1, CSB-EQ027953DU-5, CSB-EQ027953DU-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $509.00 - $4,204.00 Choose Options
CusaBio Alzheimer-associated neuronal thread protein (AD7C-NTP) ELISA Kit (human) Catalog No.(s): CSB-EQ027774HU-1, CSB-EQ027774HU-5, CSB-EQ027774HU-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $520.00 - $4,291.00 Choose Options
CusaBio Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human) Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $730.00 - $5,184.00 Choose Options
CusaBio 4-Hydroxynonenal (HNE) ELISA Kit (rat) Catalog No.(s): CSB-EQ027232RA-1, CSB-EQ027232RA-5, CSB-EQ027232RA-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $830.00 - $5,574.00 Choose Options
CusaBio Mouse Transthyretin (TTR) ELISA Kit Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $730.00 - $5,184.00 Choose Options
CusaBio Bovine Transthyretin (TTR) ELISA Kit Catalog No.(s): CSB-EL025270BO-1, CSB-EL025270BO-5, CSB-EL025270BO-10 Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time... MSRP: Was: Now: $830.00 - $5,574.00 Choose Options
