Disease

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

Cosmo Bio LTD

Elastin Glycation Assay Kit, Glyceraldehyde

Catalog No.(s): CSR-AAS-AGE-K05

Elastin is one of the extracellular matrix (ECM) proteins with the collagen that consists of many hydrophobic amino acids such as alanine, glycine, valine, and proline. Elastin is the elastic fi brous protein, which located in aorta, ligaments, lung,...

Cosmo Bio LTD

RAGE Reactive AGEs Assay Kit, Glyceraldehyde

Catalog No.(s): CSR-AAS-AGE-K04

Please click here to view other Bone-related ProductsThis kit is designed to detect GA-AGE formed on BSA using recombinant Fc-RAGE as detection reagent. This kit will be useful not only for biomarker assessment and drug screening for drug development...

Cosmo Bio LTD

Collagen AGEs Assay Kit, CMA-Specific, Glyoxal

Catalog No.(s): CSR-AAS-AGE-K03

Please click here to view other Bone-related ProductsAlthough carbohydrates are indispensable for ATP production, excess amounts of carbohydrates modify amino residues of amino acids such as lysine and arginine, and results in the irreversible functional...

Cosmo Bio LTD

Collagen AGEs Assay Kit, CML-Specific, Glyoxal

Catalog No.(s): CSR-AAS-AGE-K02

Please click here to view other Bone-related ProductsAlthough carbohydrates are indispensable for ATP production, excess amounts of carbohydrates modify amino residues of amino acids such as lysine and arginine, and results in the irreversible functional...

Cosmo Bio LTD

Albumin Glycation Assay Kit, Glyceraldehyde

Catalog No.(s): CSR-AAS-AGE-K01

For rapid detection of fluorescent AGEs and inhibition assay for glycation of albumin solution by glyceraldehyde. The non-enzymatic reaction of reducing carbohydrates with lysine side chains and N-terminal amino groups of macromolecules (proteins,...

Cosmo Bio LTD

Pristane synthetic

Catalog No.(s): CSR-42-001, CSR-42-002

Applications: Adjuvant for research of pristane-induced arthritis and for antibody production The isoprenoid alkane Pristane (2,6,10,14-tetramethylpentadecane) has found several important Applications in medical research and biotechnology including the...

CusaBio

Pro Interleukin 1 Beta (pro-IL1B) ELISA Kit (mouse)

Catalog No.(s): CSB-ET011614MO-1, CSB-ET011614MO-5, CSB-ET011614MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Testosterone (T) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ028156GU-1, CSB-EQ028156GU-5, CSB-EQ028156GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Midregional pro-Atrial Natriuretic Peptide (MR-proANP) ELISA Kit (human)

Catalog No.(s): CSB-EQ028056HU-1, CSB-EQ028056HU-5, CSB-EQ028056HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Alpha II-spectrin breakdown product SBDP145 ELISA Kit (human)

Catalog No.(s): CSB-EQ028022HU-1, CSB-EQ028022HU-5, CSB-EQ028022HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Transforming Growth Factor, Beta 1 (TGFB1) Autoantibody ELISA Kit (human)

Catalog No.(s): CSB-EQ027985HU-1, CSB-EQ027985HU-5, CSB-EQ027985HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Transforming Growth Factor, Beta 2 (TGFB2) Autoantibody ELISA Kit (human)

Catalog No.(s): CSB-EQ027984HU-1, CSB-EQ027984HU-5, CSB-EQ027984HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Lipopolysaccharides (LPS) ELISA Kit (bovine)

Catalog No.(s): CSB-EQ027975BO-1, CSB-EQ027975BO-5, CSB-EQ027975BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (horse)

Catalog No.(s): CSB-EQ027953HO-1, CSB-EQ027953HO-5, CSB-EQ027953HO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (guinea pig)

Catalog No.(s): CSB-EQ027953GU-1, CSB-EQ027953GU-5, CSB-EQ027953GU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Estradiol (E2) ELISA Kit (duck)

Catalog No.(s): CSB-EQ027953DU-1, CSB-EQ027953DU-5, CSB-EQ027953DU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Alzheimer-associated neuronal thread protein (AD7C-NTP) ELISA Kit (human)

Catalog No.(s): CSB-EQ027774HU-1, CSB-EQ027774HU-5, CSB-EQ027774HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Mouse histone H2A-H2B-DNA autoantibody ELISA kit

Catalog No.(s): CSB-EQ027767MO-1, CSB-EQ027767MO-5, CSB-EQ027767MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Calcitonin Gene Related Peptide (CGRP) ELISA Kit (mouse)

Catalog No.(s): CSB-EQ027706MO-1, CSB-EQ027706MO-5, CSB-EQ027706MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Adrenocorticotropic hormone (ACTH) ELISA Kit (sheep)

Catalog No.(s): CSB-EQ027618SH-1, CSB-EQ027618SH-5, CSB-EQ027618SH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Anti-Gliadin Antibody (IgM) ELISA Kit (human)

Catalog No.(s): CSB-EQ027573HU-1, CSB-EQ027573HU-5, CSB-EQ027573HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Angiotensin 1-7 (Ang1-7) ELISA Kit (dog)

Catalog No.(s): CSB-EQ027505DO-1, CSB-EQ027505DO-5, CSB-EQ027505DO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Fibrinogen Degradation Product (FDP) ELISA Kit (monkey)

Catalog No.(s): CSB-EQ027418MK-1, CSB-EQ027418MK-5, CSB-EQ027418MK-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (monkey)

Catalog No.(s): CSB-EQ027342MK-1, CSB-EQ027342MK-5, CSB-EQ027342MK-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (horse)

Catalog No.(s): CSB-EQ027342HO-1, CSB-EQ027342HO-5, CSB-EQ027342HO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit (chicken)

Catalog No.(s): CSB-EQ027342CH-1, CSB-EQ027342CH-5, CSB-EQ027342CH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Cortisol ELISA Kit

Catalog No.(s): CSB-EQ027342-1, CSB-EQ027342-5, CSB-EQ027342-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Beta 2 Transferrin (Beta2TF) ELISA Kit (human)

Catalog No.(s): CSB-EQ027323HU-1, CSB-EQ027323HU-5, CSB-EQ027323HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Keratin, Type I Cytoskeletal 18 (KRT18) ELISA Kit (rat)

Catalog No.(s): CSB-EQ027319RA-1, CSB-EQ027319RA-5, CSB-EQ027319RA-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Glucagon-like Peptide 2 (GLP2) ELISA Kit (pig)

Catalog No.(s): CSB-EQ027317PI-1, CSB-EQ027317PI-5, CSB-EQ027317PI-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

C-Peptide ELISA Kit (rabbit)

Catalog No.(s): CSB-EQ027310RB-1, CSB-EQ027310RB-5, CSB-EQ027310RB-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Albumin (ALB) ELISA Kit (chicken)

Catalog No.(s): CSB-EQ027303CH-1, CSB-EQ027303CH-5, CSB-EQ027303CH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...