Amyloidosis

CusaBio

Serum Amyloid A Protein (SAA1) N-terminal 6xHis-tagged (E. coli-derived, recombinant bovine)

Catalog No.(s): CSB-EP020656BOa0-20, CSB-EP020656BOa0-100, CSB-EP020656BOa0-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Serum Amyloid A Protein (SAA1) N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged (E. coli-derived, recombinant bovine)

Catalog No.(s): CSB-EP020656BO-20, CSB-EP020656BO-100, CSB-EP020656BO-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Fibrinogen Gamma Chain (FGG) N-terminal 10xHis-tagged and C-terminal Myc-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-EP008651HU-20, CSB-EP008651HU-100, CSB-EP008651HU-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Fibrinogen Beta Chain (FGB) partial, N-terminal 6xHis-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-EP008608HU-20, CSB-EP008608HU-100, CSB-EP008608HU-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Fibrinopeptide A (FGA) partial, N-terminal 6xHis-tagged (E. coli-derived, recombinant human)

Catalog No.(s): CSB-EP008607HU-20, CSB-EP008607HU-100, CSB-EP008607HU-500

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Cystatin-C (CST3) N-terminal 10xHis-tagged and C-terminal Myc-tagged (E. coli-derived, recombinant mouse)

Catalog No.(s): CSB-EP006091MO-20, CSB-EP006091MO-200

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Beta-2-Microglobulin (B2M) N-terminal 10xHis-tagged and C-terminal Myc-tagged (E. coli-derived, recombinant sheep)

Catalog No.(s): CSB-EP002486SH-20, CSB-EP002486SH-200

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Apolipoprotein A-I (APOA1) partial, N-terminal 6xHis-tagged (E. coli-derived, recombinant bovine)

Catalog No.(s): CSB-EP001913BOa0-20, CSB-EP001913BOa0-200

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Apolipoprotein A-I (APOA1) partial, N-terminal 6xHis-B2M-tagged (E. coli-derived, recombinant bovine)

Catalog No.(s): CSB-EP001913BO-20, CSB-EP001913BO-100, CSB-EP001913BO-1

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

CusaBio

Amyloid Protein A (SAA1) (Active) Tag-Free (E. coli-derived, recombinant Rhesus Macaque)

Catalog No.(s): CSB-AP001051MOW-10, CSB-AP001051MOW-100, CSB-AP001051MOW-500

If the protein is labeled as "Active", please see the page below for more information. If the protein is not labeled as "Active", please contact us to verify activity, as only sequence expression is guaranteed....

Cosmo Bio LTD

Anti BETA 2 Microglobulin (BMG) mAb (Clone 52)

Catalog No.(s): LNM-KR-012

This product was previously identified as clone 28, which was incorrect. The correct clone is 52. Product Specifications Application ELISA Reactivity Human Clonality Monoclonal (Clone No.: 28) Host Mouse

Cosmo Bio LTD

Anti BETA 2 Microglobulin (BMG) mAb (Clone 37)

Catalog No.(s): LNM-KR-011

Product Specifications Application ELISA Reactivity Human Clonality Monoclonal (Clone No.: 37) Host Mouse

Cosmo Bio LTD

Transthyretin (Met)

Catalog No.(s): CSR-KN-TOYU-M02

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNPKEWarning: Store...

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

CusaBio

Mouse Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Bovine Transthyretin (TTR) ELISA Kit

Catalog No.(s): CSB-EL025270BO-1, CSB-EL025270BO-5, CSB-EL025270BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A4 protein (SAA4) ELISA Kit (human)

Catalog No.(s): CSB-EL020659HU-1, CSB-EL020659HU-5, CSB-EL020659HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A3 Protein (SAA3) ELISA Kit (mouse)

Catalog No.(s): CSB-EL020658MO-1, CSB-EL020658MO-5, CSB-EL020658MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A2 (SAA2) ELISA Kit (mouse)

Catalog No.(s): CSB-EL020657MO-1, CSB-EL020657MO-5, CSB-EL020657MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A2 (SAA2) ELISA Kit (human)

Catalog No.(s): CSB-EL020657HU-1, CSB-EL020657HU-5, CSB-EL020657HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A1 (SAA1) ELISA Kit (monkey)

Catalog No.(s): CSB-EL020656RH-1, CSB-EL020656RH-5, CSB-EL020656RH-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A1 (SAA1) ELISA Kit (mouse)

Catalog No.(s): CSB-EL020656MO-1, CSB-EL020656MO-5, CSB-EL020656MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Transmembrane Glycoprotein NMB (GPNMB) ELISA Kit (mouse)

Catalog No.(s): CSB-EL009727MO-1, CSB-EL009727MO-5, CSB-EL009727MO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Transmembrane Glycoprotein NMB (GPNMB) ELISA Kit (human)

Catalog No.(s): CSB-EL009727HU-1, CSB-EL009727HU-5, CSB-EL009727HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Fibrinogen Alpha Chain (FGA) ELISA Kit (human)

Catalog No.(s): CSB-EL008607HU-1, CSB-EL008607HU-5, CSB-EL008607HU-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Apolipoprotein A-I (APOA1) ELISA Kit (dog)

Catalog No.(s): CSB-EL001913DO-1, CSB-EL001913DO-5, CSB-EL001913DO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Apolipoprotein A-I (APOA1) ELISA Kit (bovine)

Catalog No.(s): CSB-EL001913BO-1, CSB-EL001913BO-5, CSB-EL001913BO-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Fibrinogen (Fb) ELISA Kit (horse)

Catalog No.(s): CSB-E17079Hs-1, CSB-E17079Hs-5, CSB-E17079Hs-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A (SAA) ELISA Kit (sheep)

Catalog No.(s): CSB-E14973Sh-1, CSB-E14973Sh-5, CSB-E14973Sh-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Dog beta2-microglobulin,BMG/beta2-MG ELISA Kit

Catalog No.(s): CSB-E13768c-1, CSB-E13768c-5, CSB-E13768c-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Fibrinogen (FB) ELISA Kit (human)

Catalog No.(s): CSB-E13656h-1, CSB-E13656h-5, CSB-E13656h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Fibrinogen Gamma Chain (FGG) ELISA Kit (human)

Catalog No.(s): CSB-E13319h-1, CSB-E13319h-5, CSB-E13319h-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Serum Amyloid A (SAA) ELISA Kit (pig)

Catalog No.(s): CSB-E13309p-1, CSB-E13309p-5, CSB-E13309p-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Fibrinogen (Fb) ELISA Kit (bovine)

Catalog No.(s): CSB-E13283B-1, CSB-E13283B-5, CSB-E13283B-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

CusaBio

Canine prealbumin (PA) ELISA Kit

Catalog No.(s): CSB-E13252c-1, CSB-E13252c-5, CSB-E13252c-10

Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...