Alzheimer's Disease

  • Transthyretin (His-Tag)

    Cosmo Bio LTD

    Transthyretin (His-Tag)

    Catalog No.(s): CSR-KN-TOYU-M01

    Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

    $294.00
    Choose Options
  • Alzheimer-associated neuronal thread protein (AD7C-NTP) ELISA Kit (human)

    CusaBio

    Alzheimer-associated neuronal thread protein (AD7C-NTP) ELISA Kit (human)

    Catalog No.(s): CSB-EQ027774HU-1, CSB-EQ027774HU-5, CSB-EQ027774HU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $520.00 - $4,291.00
    Choose Options
  • Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

    CusaBio

    Soluble Amyloid Precursor Protein Alpha (sAPPα) ELISA Kit (human)

    Catalog No.(s): CSB-EQ027464HU-1, CSB-EQ027464HU-5, CSB-EQ027464HU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $730.00 - $5,184.00
    Choose Options
  • Metallothionein (MT) ELISA Kit (fish)

    CusaBio

    Metallothionein (MT) ELISA Kit (fish)

    Catalog No.(s): CSB-EQ027262FI-1, CSB-EQ027262FI-5, CSB-EQ027262FI-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Mouse Transthyretin (TTR) ELISA Kit

    CusaBio

    Mouse Transthyretin (TTR) ELISA Kit

    Catalog No.(s): CSB-EL025270MO-1, CSB-EL025270MO-5, CSB-EL025270MO-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $730.00 - $5,184.00
    Choose Options
  • Bovine Transthyretin (TTR) ELISA Kit

    CusaBio

    Bovine Transthyretin (TTR) ELISA Kit

    Catalog No.(s): CSB-EL025270BO-1, CSB-EL025270BO-5, CSB-EL025270BO-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Mouse Protein disulfide-isomerase(P4HB) ELISA kit

    CusaBio

    Mouse Protein disulfide-isomerase(P4HB) ELISA kit

    Catalog No.(s): CSB-EL017342MO-1, CSB-EL017342MO-5, CSB-EL017342MO-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $730.00 - $5,184.00
    Choose Options
  • Heat Shock Cognate 71 kDa Protein (HSPA8) ELISA Kit (human)

    CusaBio

    Heat Shock Cognate 71 kDa Protein (HSPA8) ELISA Kit (human)

    Catalog No.(s): CSB-EL010829HU-1, CSB-EL010829HU-5, CSB-EL010829HU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $730.00 - $5,184.00
    Choose Options
  • Human Calbindin(CALB1) ELISA kit

    CusaBio

    Human Calbindin(CALB1) ELISA kit

    Catalog No.(s): CSB-EL004432HU-1, CSB-EL004432HU-5, CSB-EL004432HU-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $730.00 - $5,184.00
    Choose Options
  • Amyloid Beta A4 Protein (APP) ELISA Kit (rat)

    CusaBio

    Amyloid Beta A4 Protein (APP) ELISA Kit (rat)

    Catalog No.(s): CSB-EL001950RA-1, CSB-EL001950RA-5, CSB-EL001950RA-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $625.00 - $4,918.00
    Choose Options
  • Apolipoprotein E (APOE) ELISA Kit (monkey)

    CusaBio

    Apolipoprotein E (APOE) ELISA Kit (monkey)

    Catalog No.(s): CSB-EL001936RH-1, CSB-EL001936RH-5, CSB-EL001936RH-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $625.00 - $4,918.00
    Choose Options
  • Apolipoprotein E (Apo-E) ELISA Kit (pig)

    CusaBio

    Apolipoprotein E (Apo-E) ELISA Kit (pig)

    Catalog No.(s): CSB-E17889p-1, CSB-E17889p-5, CSB-E17889p-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $473.00 - $3,901.00
    Choose Options
  • TAR DNA-binding protein 43 (TARDBP/TDP-43) ELISA Kit (human)

    CusaBio

    TAR DNA-binding protein 43 (TARDBP/TDP-43) ELISA Kit (human)

    Catalog No.(s): CSB-E17007h-1, CSB-E17007h-5, CSB-E17007h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $730.00 - $5,184.00
    Choose Options
  • Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (monkey)

    CusaBio

    Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (monkey)

    Catalog No.(s): CSB-E14398Mk-1, CSB-E14398Mk-5, CSB-E14398Mk-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Mouse Metallothionein-2(MT-2) ELISA Kit

    CusaBio

    Mouse Metallothionein-2(MT-2) ELISA Kit

    Catalog No.(s): CSB-E13693m-1, CSB-E13693m-5, CSB-E13693m-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Rabbit Myeloperoxidase (MPO) ELISA kit

    CusaBio

    Rabbit Myeloperoxidase (MPO) ELISA kit

    Catalog No.(s): CSB-E13689Rb-1, CSB-E13689Rb-5, CSB-E13689Rb-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $625.00 - $4,918.00
    Choose Options
  • Human Metallothionein-2(MT-2) ELISA Kit

    CusaBio

    Human Metallothionein-2(MT-2) ELISA Kit

    Catalog No.(s): CSB-E13535h-1, CSB-E13535h-5, CSB-E13535h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Canine prealbumin (PA) ELISA Kit

    CusaBio

    Canine prealbumin (PA) ELISA Kit

    Catalog No.(s): CSB-E13252c-1, CSB-E13252c-5, CSB-E13252c-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $899.00 - $6,040.00
    Choose Options
  • Rat Prealbumin (PA) ELISA Kit

    CusaBio

    Rat Prealbumin (PA) ELISA Kit

    Catalog No.(s): CSB-E13251r-1, CSB-E13251r-5, CSB-E13251r-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Dog Myeloperoxidase (MPO) ELISA kit

    CusaBio

    Dog Myeloperoxidase (MPO) ELISA kit

    Catalog No.(s): CSB-E12762c-1, CSB-E12762c-5, CSB-E12762c-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $877.00 - $5,892.00
    Choose Options
  • Binding-Immunoglobulin Protein (HSPA5) ELISA Kit (human)

    CusaBio

    Binding-Immunoglobulin Protein (HSPA5) ELISA Kit (human)

    Catalog No.(s): CSB-E12119h-1, CSB-E12119h-5, CSB-E12119h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $625.00 - $4,918.00
    Choose Options
  • Rat Metallothionein,MT ELISA Kit

    CusaBio

    Rat Metallothionein,MT ELISA Kit

    Catalog No.(s): CSB-E11315r-1, CSB-E11315r-5, CSB-E11315r-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Human Transthyretin (TTR) ELISA Kit

    CusaBio

    Human Transthyretin (TTR) ELISA Kit

    Catalog No.(s): CSB-E11169h-1, CSB-E11169h-5, CSB-E11169h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $730.00 - $5,184.00
    Choose Options
  • Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (mouse)

    CusaBio

    Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (mouse)

    Catalog No.(s): CSB-E10787m-1, CSB-E10787m-5, CSB-E10787m-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $877.00 - $5,892.00
    Choose Options
  • Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (rat)

    CusaBio

    Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (rat)

    Catalog No.(s): CSB-E10786r-1, CSB-E10786r-5, CSB-E10786r-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $899.00 - $6,040.00
    Choose Options
  • Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (human)

    CusaBio

    Amyloid Beta Peptide 1-42 (Aβ1-42) ELISA Kit (human)

    Catalog No.(s): CSB-E10684h-1, CSB-E10684h-5, CSB-E10684h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Human Beta-Site APP-Cleaving Enzyme 1 (BACE1) ELISA Kit

    CusaBio

    Human Beta-Site APP-Cleaving Enzyme 1 (BACE1) ELISA Kit

    Catalog No.(s): CSB-E09824h-1, CSB-E09824h-5, CSB-E09824h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Apolipoprotein E (Apo-E) ELISA Kit (mouse)

    CusaBio

    Apolipoprotein E (Apo-E) ELISA Kit (mouse)

    Catalog No.(s): CSB-E09750m-1, CSB-E09750m-5, CSB-E09750m-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $473.00 - $3,901.00
    Choose Options
  • Apolipoprotein E (Apo-E) ELISA Kit (rat)

    CusaBio

    Apolipoprotein E (Apo-E) ELISA Kit (rat)

    Catalog No.(s): CSB-E09749r-1, CSB-E09749r-5, CSB-E09749r-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $473.00 - $3,901.00
    Choose Options
  • Apolipoprotein E (Apo-E) ELISA Kit (human)

    CusaBio

    Apolipoprotein E (Apo-E) ELISA Kit (human)

    Catalog No.(s): CSB-E09748h-1, CSB-E09748h-5, CSB-E09748h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $473.00 - $3,901.00
    Choose Options
  • Pig Myeloperoxidase (MPO) ELISA kit

    CusaBio

    Pig Myeloperoxidase (MPO) ELISA kit

    Catalog No.(s): CSB-E09397p-1, CSB-E09397p-5, CSB-E09397p-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $899.00 - $6,040.00
    Choose Options
  • Human Metallothionein,MT ELISA Kit

    CusaBio

    Human Metallothionein,MT ELISA Kit

    Catalog No.(s): CSB-E09060h-1, CSB-E09060h-5, CSB-E09060h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $520.00 - $4,291.00
    Choose Options
  • Human protein disulfide isomerase,PDI ELISA Kit

    CusaBio

    Human protein disulfide isomerase,PDI ELISA Kit

    Catalog No.(s): CSB-E09003h-1, CSB-E09003h-5, CSB-E09003h-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $830.00 - $5,574.00
    Choose Options
  • Mouse myeloperoxidase,MPO ELISA Kit

    CusaBio

    Mouse myeloperoxidase,MPO ELISA Kit

    Catalog No.(s): CSB-E08723m-1, CSB-E08723m-5, CSB-E08723m-10

    Attention first time users: evaluate the suitability of this ELISA Kit for your experiments. Purchase a complete 24-well test kit for only $150. Then, save $30 per kit on the subsequent purchase of up to five 96-well kits purchased at the same time...

    $877.00 - $5,892.00
    Choose Options