Labeled Proteins

Ubiquigent

UBE2D2 (UbcH5b) [GST-tagged]

Catalog No.(s): UBI-62-0011-100, UBI-62-0011-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBE2D1 (UbcH5a) [GST-tagged]

Catalog No.(s): UBI-62-0009-100, UBI-62-0009-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBE2D1 (UbcH5a) [6His-tagged]

Catalog No.(s): UBI-62-0008-100, UBI-62-0008-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBE2C (UbcH10) [GST-tagged]

Catalog No.(s): UBI-62-0006-100, UBI-62-0006-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBE2C (UbcH10) [6His-tagged]

Catalog No.(s): UBI-62-0005-100, UBI-62-0005-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBE2B (HR6B) [GST-tagged]

Catalog No.(s): UBI-62-0003-100, UBI-62-0003-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBE2A (HR6A) [GST-tagged]

Catalog No.(s): UBI-62-0001-100, UBI-62-0001-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

ATG7 [6His-tagged]

Catalog No.(s): UBI-61-0008-010, UBI-61-0008-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBA7 [6His-tagged]

Catalog No.(s): UBI-61-0007-010, UBI-61-0007-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

SAE1 [GST-tagged] / SAE2 [6His-tagged]

Catalog No.(s): UBI-61-0005-010, UBI-61-0005-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBA6 [6His-tagged]

Catalog No.(s): UBI-61-0002-010, UBI-61-0002-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

UBE1 [6His-tagged]

Catalog No.(s): UBI-61-0001-010, UBI-61-0001-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

Biotin-Ahx-ubiquitin (synthetic)

Catalog No.(s): UBI-60-0201-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

4x Ubiquitin-Rhodamine 110

Catalog No.(s): UBI-60-0122-500

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

Biotinylated Ubiquitin

Catalog No.(s): UBI-60-0121-100, UBI-60-0121-020

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

Ubiquitin-Lys-TAMRA (5-TAMRA-Lys(Ub)-Gly-OH)

Catalog No.(s): UBI-60-0118-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

Ubiquitin-Rhodamine 110

Catalog No.(s): UBI-60-0117-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

Ubiquitin-AMC

Catalog No.(s): UBI-60-0116-050

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

LC3b [GST-tagged]

Catalog No.(s): UBI-60-0111-500

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

LC3b [6His-tagged]

Catalog No.(s): UBI-60-0110-500

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

SUMO2 [6His-tagged]

Catalog No.(s): UBI-60-0003-500

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Ubiquigent

SUMO1 [6His-tagged]

Catalog No.(s): UBI-60-0002-500

Click here to view the UbiquigentTM Product Dashboard and hundreds of great reagents for ubiquitin-proteasome-related research.Customer Notice Regarding Orders for Ubiquigent Products: From September 2020, orders for Ubiquigent products must total...

Cosmo Bio LTD

Hyaluronan Binding Protein (HABP), recombinant Versican G1 domain (Biotin Conj.)

Catalog No.(s): HKD-BC41

Hyaluronan Binding Protein [HABP] (Biotin Conj.) is a biotinylated derivative of recombinant versican G1-domain of HABP purified from E. coli BL21 (DE3)-RIL. ...

Compared to animal derived HABP, this product has high biological safety. It specifically detects hyaluronan and does not bind to other glycosaminoglycans nor to DNA....

Cosmo Bio LTD

Transthyretin (His-Tag)

Catalog No.(s): CSR-KN-TOYU-M01

Click here for the Neuroscience Products Dashboard Page Recombinant Protein / Transthyretin (His-Tag)Sequence: MRGSHHHHHHGSGPTGTGESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIA...

Cosmo Bio LTD

Mild-AGE-BSA

Catalog No.(s): CSR-AGE-GP05

Fatty acid-free bovine serum albumin (BSA) (0.05 g/ml) was incubated with 50 mM of glucose in a 0.05 M sodium phosphate buffer (pH 7.4) at 37°C for 24 weeks, followed by dialysis against PBS. The CML content (0.4 mol CML/mol BSA) was...

Cosmo Bio LTD

GA-BSA

Catalog No.(s): CSR-AGE-GP03

Glycolaldehyde (33 mM) was incubated with bovine serum albumin (BSA) (2 mg/ml) at 37°C for  7 days in PBS (pH 7.4), and dialyzed against PBS.Concentration: 1 mg/ml

Cosmo Bio LTD

CEL-BSA

Catalog No.(s): CSR-AGE-GP02

Bovine serum albumin (BSA) (50 mg/ml) was incubated at 37°C for 24 h with pyruvate and 100  mM sodium cyanoborohydride in 0.2 M sodium phosphate buffer (pH 7.8), followed by dialysis  against PBS. The CEL content (2.6 mol...

Cosmo Bio LTD

CML-BSA

Catalog No.(s): CSR-AGE-GP01

Bovine serum albumin (BSA) (50 mg/ml) was incubated at 37°C for 24 h with glyoxylic acid and  100 mM sodium cyanoborohydride in 0.2 M sodium phosphate buffer (pH 7.8), followed by dialysis against PBS. The CML content (2.3 mol...