Antibodies

  • Immunofluorescent staining of human cell line U2OS shows localization to the Golgi apparatus.

    Atlas

    Anti-FKBP10 pAb (ATL-HPA013808)

    Catalog No.(s): ATL-HPA013808

    Application: ICC, WB Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human FKBP10, Gene description: FKBP prolyl isomerase 10, Alternative Gene Names: FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line hTERT-RPE1 shows localization to the Golgi apparatus.

    Atlas

    Anti-GPC6 pAb (ATL-HPA013601)

    Catalog No.(s): ATL-HPA013601

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human GPC6, Gene description: glypican 6, Validated applications: ICC, Uniprot ID: Q9Y625, Storage: Store at +4°C for short term storage...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line OE19 shows localization to plasma membrane & cytosol.

    Atlas

    Anti-KCNN4 pAb (ATL-HPA013367)

    Catalog No.(s): ATL-HPA013367

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human KCNN4, Gene description: potassium calcium-activated channel subfamily N member 4, Alternative Gene Names: hIKCa1, hKCa4, hSK4,...

    $505.00
    Choose Options
  • Immunofluorescent staining of human cell line THP-1 shows localization to nucleoplasm, mitotic chromosome & centrosome.

    Atlas

    Anti-FANCE pAb (ATL-HPA013343)

    Catalog No.(s): ATL-HPA013343

    Application: ICC, WB Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human FANCE, Gene description: FA complementation group E, Alternative Gene Names: FACE, FAE, Validated applications: ICC, WB,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line RT-4 shows localization to focal adhesion sites.

    Atlas

    Anti-PEAK1 pAb (ATL-HPA012773)

    Catalog No.(s): ATL-HPA012773

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human PEAK1, Gene description: pseudopodium enriched atypical kinase 1, Alternative Gene Names: KIAA2002, sgk269, Validated...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line GAMG shows localization to nucleoli.

    Atlas

    Anti-TCEAL9 pAb (ATL-HPA012106)

    Catalog No.(s): ATL-HPA012106

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human TCEAL9, Gene description: transcription elongation factor A like 9, Alternative Gene Names: DKFZp313K1940, WBP5, WEX6, Validated...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line HAP1 shows localization to nucleoplasm & cell junctions.

    Atlas

    Anti-CDH10 pAb (ATL-HPA012085)

    Catalog No.(s): ATL-HPA012085

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human CDH10, Gene description: cadherin 10, Validated applications: ICC, Uniprot ID: Q9Y6N8, Storage: Store at +4°C for short term...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line HDLM-2 shows localization to cytosol & vesicles.

    Atlas

    Anti-KSR1 pAb (ATL-HPA011878)

    Catalog No.(s): ATL-HPA011878

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human KSR1, Gene description: kinase suppressor of ras 1, Alternative Gene Names: KSR, RSU2, Validated applications: ICC, Uniprot ID:...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line RT-4 shows localization to vesicles.

    Atlas

    Anti-ACSL1 pAb (ATL-HPA011317)

    Catalog No.(s): ATL-HPA011317

    Application: ICC, WB Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human ACSL1, Gene description: acyl-CoA synthetase long chain family member 1, Alternative Gene Names: ACS1, FACL1, FACL2, LACS,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line HEL shows localization to vesicles.

    Atlas

    Anti-SELPLG pAb (ATL-HPA011256)

    Catalog No.(s): ATL-HPA011256

    Application: ICC, WB Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human SELPLG, Gene description: selectin P ligand, Alternative Gene Names: CD162, PSGL-1, Validated applications: ICC, WB, Uniprot...

    $505.00
    Choose Options
  • Immunofluorescent staining of human cell line U2OS shows localization to vesicles.

    Atlas

    Anti-SEMA3D pAb (ATL-HPA011183)

    Catalog No.(s): ATL-HPA011183

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human SEMA3D, Gene description: semaphorin 3D, Alternative Gene Names: coll-2, Sema-Z2, Validated applications: ICC, Uniprot ID: O95025,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line U-251MG shows localization to microtubules, cytokinetic bridge & mitotic spindle.

    Atlas

    Anti-CENPE pAb (ATL-HPA011110)

    Catalog No.(s): ATL-HPA011110

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human CENPE, Gene description: centromere protein E, Alternative Gene Names: KIF10, PPP1R61, Validated applications: ICC, Uniprot ID:...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line A-549 shows localization to cytosol, microtubules & cytokinetic bridge.

    Atlas

    Anti-JPT1 pAb (ATL-HPA011097)

    Catalog No.(s): ATL-HPA011097

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human JPT1, Gene description: Jupiter microtubule associated homolog 1, Alternative Gene Names: ARM2, HN1, HN1A, Validated applications:...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line U2OS shows localization to mitochondria.

    Atlas

    Anti-C17orf80 pAb (ATL-HPA010974)

    Catalog No.(s): ATL-HPA010974

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human C17orf80, Gene description: chromosome 17 open reading frame 80, Alternative Gene Names: FLJ20721, HLC-8, MIG3, SPEP1, Validated...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line HAP1 shows localization to the Golgi apparatus.

    Atlas

    Anti-CDHR1 pAb (ATL-HPA010795)

    Catalog No.(s): ATL-HPA010795

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human CDHR1, Gene description: cadherin related family member 1, Alternative Gene Names: CORD15, KIAA1775, PCDH21, RP65, Validated...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line Rh30 shows localization to mitochondria.

    Atlas

    Anti-CYB5R1 pAb (ATL-HPA010531)

    Catalog No.(s): ATL-HPA010531

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human CYB5R1, Gene description: cytochrome b5 reductase 1, Alternative Gene Names: humb5R2, NQO3A2, Validated applications: ICC, Uniprot...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line U2OS shows localization to nucleoplasm, nucleoli & mitochondria.

    Atlas

    Anti-FAM171B pAb (ATL-HPA010529)

    Catalog No.(s): ATL-HPA010529

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human FAM171B, Gene description: family with sequence similarity 171 member B, Alternative Gene Names: FLJ34104, KIAA1946, Validated...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line HaCaT shows localization to nuclear bodies & endoplasmic reticulum.

    Atlas

    Anti-NT5C3A pAb (ATL-HPA010520)

    Catalog No.(s): ATL-HPA010520

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human NT5C3A, Gene description: 5'-nucleotidase, cytosolic IIIA, Alternative Gene Names: cN-III, hUMP1, NT5C3, p36, P5'N-1, PN-I, POMP,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line THP-1 shows localization to plasma membrane & cytosol.

    Atlas

    Anti-PSTPIP1 pAb (ATL-HPA010116)

    Catalog No.(s): ATL-HPA010116

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human PSTPIP1, Gene description: proline-serine-threonine phosphatase interacting protein 1, Alternative Gene Names: CD2BP1, CD2BP1L,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line U2OS shows localization to nuclear speckles.

    Atlas

    Anti-WRN pAb (ATL-HPA009423)

    Catalog No.(s): ATL-HPA009423

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human WRN, Gene description: WRN RecQ like helicase, Alternative Gene Names: RECQ3, RECQL2, Validated applications: ICC, Uniprot ID:...

    $505.00
    Choose Options
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to plasma membrane & vesicles.

    Atlas

    Anti-ADGRA2 pAb (ATL-HPA008984)

    Catalog No.(s): ATL-HPA008984

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human ADGRA2, Gene description: adhesion G protein-coupled receptor A2, Alternative Gene Names: DKFZp434C211, DKFZp434J0911, FLJ14390,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.

    Atlas

    Anti-GLT8D1 pAb (ATL-HPA008808)

    Catalog No.(s): ATL-HPA008808

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human GLT8D1, Gene description: glycosyltransferase 8 domain containing 1, Alternative Gene Names: AD-017, FLJ14611, Validated...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line PC-3 shows localization to nuclear speckles, plasma membrane & cytosol.

    Atlas

    Anti-PTPRH pAb (ATL-HPA008708)

    Catalog No.(s): ATL-HPA008708

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human PTPRH, Gene description: protein tyrosine phosphatase receptor type H, Alternative Gene Names: SAP-1, Validated applications: ICC,...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line SiHa shows localization to cytosol.

    Atlas

    Anti-PDPK1 pAb (ATL-HPA008062)

    Catalog No.(s): ATL-HPA008062

    Application: ICC, WB Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human PDPK1, Gene description: 3-phosphoinositide dependent protein kinase 1, Alternative Gene Names: PDK1, Validated applications:...

    $505.00
    Choose Options
  • Immunofluorescent staining of human cell line HAP1 shows localization to the Golgi apparatus.

    Atlas

    Anti-B3GALNT2 pAb (ATL-HPA007846)

    Catalog No.(s): ATL-HPA007846

    Application: ICC, WB Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human B3GALNT2, Gene description: beta-1,3-N-acetylgalactosaminyltransferase 2, Alternative Gene Names: MGC39558, Validated...

    $535.00
    Choose Options
  • Immunofluorescent staining of human cell line U2OS shows localization to nucleoplasm, nuclear bodies & plasma membrane.

    Atlas

    Anti-RALBP1 pAb (ATL-HPA007622)

    Catalog No.(s): ATL-HPA007622

    Application: ICC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human RALBP1, Gene description: ralA binding protein 1, Alternative Gene Names: RIP, RIP1, RLIP76, Validated applications: ICC, Uniprot...

    $505.00
    Choose Options
  • Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in cells of molecular layer.

    Atlas

    Anti-FBXL5 pAb (ATL-HPA002484)

    Catalog No.(s): ATL-HPA002484

    Application: IHC Clonality: Polyclonal Host: Rabbit Reactivity: Human Polyclonal Antibody against Human FBXL5, Gene description: F-box and leucine rich repeat protein 5, Alternative Gene Names: FBL4, FBL5, FLR1, Validated...

    $535.00
    Choose Options

  • Atlas

    PrEST Antigen ZNF226 (ATL-APrEST96237)

    Catalog No.(s): ATL-APrEST96237

    PrEST Antigen ZNF226, Gene description: zinc finger protein 226, Antigen sequence: QRLNRDQQISIKNKLCQCKKGVDPIGWISHHDGHRVHKSEKSYRPNDYEKDNMKILTFDHNSMIHTGHK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Cognate Antibody/Antigen...

    $290.00
    Choose Options

  • Atlas

    PrEST Antigen CENPJ (ATL-APrEST96236)

    Catalog No.(s): ATL-APrEST96236

    PrEST Antigen CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4, Antigen sequence:...

    $290.00
    Choose Options

  • Atlas

    PrEST Antigen ZDHHC15 (ATL-APrEST96235)

    Catalog No.(s): ATL-APrEST96235

    PrEST Antigen ZDHHC15, Gene description: zinc finger DHHC-type palmitoyltransferase 15, Alternative Gene Names: DHHC15, FLJ31812, MRX91, Antigen sequence: NEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIK, Storage: Upon delivery store at -20°C. Avoid repeated...

    $290.00
    Choose Options

  • Atlas

    PrEST Antigen ZNF20 (ATL-APrEST96234)

    Catalog No.(s): ATL-APrEST96234

    PrEST Antigen ZNF20, Gene description: zinc finger protein 20, Alternative Gene Names: KOX13, Antigen sequence: SYLDSFQSHDKACTKEKPYDGKECTET, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Cognate Antibody/Antigen for PrEST...

    $290.00
    Choose Options