PrEST Antigen ZUP1 (ATL-APrEST95798)

Catalog No:
ATL-APrEST95798-100
$345.00

Description

Product Description

PrEST Antigen ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Antigen sequence: TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA
Gene ID - Mouse ENSMUSG00000039531
Gene ID - Rat ENSRNOG00000000398
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen ZUP1 (ATL-APrEST95798)
Vendor Page PrEST Antigen ZUP1 (ATL-APrEST95798) at Atlas Antibodies

Documents & Links for PrEST Antigen ZUP1 (ATL-APrEST95798)
Vendor Page PrEST Antigen ZUP1 (ATL-APrEST95798)

Product Description

PrEST Antigen ZUP1, Gene description: zinc finger containing ubiquitin peptidase 1, Alternative Gene Names: C6orf113, dJ412I7.3, ZUFSP, Antigen sequence: TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence TSKPPIYLQHQGHSRTVIGIEEKKNRTLCLLILDPGCPSREMQKLLKQDIEASSLKQLRKSMGNLKHKQYQILAVEGALSLEEKLARRQASQVFTA
Gene ID - Mouse ENSMUSG00000039531
Gene ID - Rat ENSRNOG00000000398
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen ZUP1 (ATL-APrEST95798)
Vendor Page PrEST Antigen ZUP1 (ATL-APrEST95798) at Atlas Antibodies

Documents & Links for PrEST Antigen ZUP1 (ATL-APrEST95798)
Vendor Page PrEST Antigen ZUP1 (ATL-APrEST95798)