PrEST Antigen ZNF474 (ATL-APrEST95690)

Catalog No:
ATL-APrEST95690-100
$345.00

Description

Product Description

PrEST Antigen ZNF474, Gene description: zinc finger protein 474, Alternative Gene Names: 4933409D10Rik, FLJ32921, Antigen sequence: GSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKPKGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence GSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKPKGE
Gene ID - Mouse ENSMUSG00000046886
Gene ID - Rat ENSRNOG00000018724
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen ZNF474 (ATL-APrEST95690)
Vendor Page PrEST Antigen ZNF474 (ATL-APrEST95690) at Atlas Antibodies

Documents & Links for PrEST Antigen ZNF474 (ATL-APrEST95690)
Vendor Page PrEST Antigen ZNF474 (ATL-APrEST95690)

Product Description

PrEST Antigen ZNF474, Gene description: zinc finger protein 474, Alternative Gene Names: 4933409D10Rik, FLJ32921, Antigen sequence: GSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKPKGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence GSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKPKGE
Gene ID - Mouse ENSMUSG00000046886
Gene ID - Rat ENSRNOG00000018724
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen ZNF474 (ATL-APrEST95690)
Vendor Page PrEST Antigen ZNF474 (ATL-APrEST95690) at Atlas Antibodies

Documents & Links for PrEST Antigen ZNF474 (ATL-APrEST95690)
Vendor Page PrEST Antigen ZNF474 (ATL-APrEST95690)