Description
Product Description
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications
| Product Specifications | |
| Gene Sequence | AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP |
| Gene ID - Mouse | ENSMUSG00000048485 |
| Gene ID - Rat | ENSRNOG00000026898 |
| Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links
| Documents & Links for PrEST Antigen ZBTB8B (ATL-APrEST95606) | |
| Vendor Page | PrEST Antigen ZBTB8B (ATL-APrEST95606) at Atlas Antibodies |
| Documents & Links for PrEST Antigen ZBTB8B (ATL-APrEST95606) | |
| Vendor Page | PrEST Antigen ZBTB8B (ATL-APrEST95606) |