Description
Product Description
PrEST Antigen ZBTB8B, Gene description: zinc finger and BTB domain containing 8B, Alternative Gene Names: DKFZp547H154, RP1-27O5.1, ZNF916B, Antigen sequence: AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications
Product Specifications | |
Gene Sequence | AVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHFSRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVP |
Gene ID - Mouse | ENSMUSG00000048485 |
Gene ID - Rat | ENSRNOG00000026898 |
Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links
Documents & Links for PrEST Antigen ZBTB8B (ATL-APrEST95606) | |
Vendor Page | PrEST Antigen ZBTB8B (ATL-APrEST95606) at Atlas Antibodies |
Documents & Links for PrEST Antigen ZBTB8B (ATL-APrEST95606) | |
Vendor Page | PrEST Antigen ZBTB8B (ATL-APrEST95606) |