Protein Description: zinc finger and BTB domain containing 12
Gene Name: ZBTB12
Alternative Gene Name: C6orf46, D6S59E, G10, NG35
Sequence: GLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACY
Interspecies mouse/rat: ENSMUSG00000049823: 83%, ENSRNOG00000000418: 89%
Entrez Gene ID: 221527
Uniprot ID: Q9Y330
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ZBTB12
Alternative Gene Name: C6orf46, D6S59E, G10, NG35
Sequence: GLGIGGSVGGHLGELAQSSVPPSTVAPPQGVVKACY
Interspecies mouse/rat: ENSMUSG00000049823: 83%, ENSRNOG00000000418: 89%
Entrez Gene ID: 221527
Uniprot ID: Q9Y330
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen ZBTB12 (ATL-APrEST83286) | |
Antibody | Anti ZBTB12 pAb (ATL-HPA047161) |
Documents & Links for PrEST Antigen ZBTB12 (ATL-APrEST83286) | |
Datasheet | PrEST Antigen ZBTB12 (ATL-APrEST83286) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB12 (ATL-APrEST83286) at Atlas |
Documents & Links for PrEST Antigen ZBTB12 (ATL-APrEST83286) | |
Datasheet | PrEST Antigen ZBTB12 (ATL-APrEST83286) Datasheet (External Link) |
Vendor Page | PrEST Antigen ZBTB12 (ATL-APrEST83286) |