Protein Description: vacuolar protein sorting 13 homolog B (yeast)
Gene Name: VPS13B
Alternative Gene Name: CHS1, COH1
Sequence: PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
Interspecies mouse/rat: ENSMUSG00000037646: 83%, ENSRNOG00000057443: 27%
Entrez Gene ID: 157680
Uniprot ID: Q7Z7G8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: VPS13B
Alternative Gene Name: CHS1, COH1
Sequence: PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR
Interspecies mouse/rat: ENSMUSG00000037646: 83%, ENSRNOG00000057443: 27%
Entrez Gene ID: 157680
Uniprot ID: Q7Z7G8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen VPS13B (ATL-APrEST89476) | |
| Antibody | Anti VPS13B pAb (ATL-HPA043865) |
| Documents & Links for PrEST Antigen VPS13B (ATL-APrEST89476) | |
| Datasheet | PrEST Antigen VPS13B (ATL-APrEST89476) Datasheet (External Link) |
| Vendor Page | PrEST Antigen VPS13B (ATL-APrEST89476) at Atlas |
| Documents & Links for PrEST Antigen VPS13B (ATL-APrEST89476) | |
| Datasheet | PrEST Antigen VPS13B (ATL-APrEST89476) Datasheet (External Link) |
| Vendor Page | PrEST Antigen VPS13B (ATL-APrEST89476) |