Protein Description: UTP4, small subunit processome component
Gene Name: UTP4
Alternative Gene Name: CIRHIN, FLJ14728, KIAA1988, NAIC, TEX292, UTP4
Sequence: RVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQ
Interspecies mouse/rat: ENSMUSG00000041438: 96%, ENSRNOG00000020333: 98%
Entrez Gene ID: 84916
Uniprot ID: Q969X6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UTP4
Alternative Gene Name: CIRHIN, FLJ14728, KIAA1988, NAIC, TEX292, UTP4
Sequence: RVRFFNYVPSGIRCVAYNNQSNRLAVSRTDGTVEIYNLSANYFQEKFFPGHESRATEALCWAEGQRLFSAGLNGEIMEYDLQ
Interspecies mouse/rat: ENSMUSG00000041438: 96%, ENSRNOG00000020333: 98%
Entrez Gene ID: 84916
Uniprot ID: Q969X6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen UTP4 (ATL-APrEST90977) | |
Antibody | Anti UTP4 pAb (ATL-HPA043542) |
Documents & Links for PrEST Antigen UTP4 (ATL-APrEST90977) | |
Datasheet | PrEST Antigen UTP4 (ATL-APrEST90977) Datasheet (External Link) |
Vendor Page | PrEST Antigen UTP4 (ATL-APrEST90977) at Atlas |
Documents & Links for PrEST Antigen UTP4 (ATL-APrEST90977) | |
Datasheet | PrEST Antigen UTP4 (ATL-APrEST90977) Datasheet (External Link) |
Vendor Page | PrEST Antigen UTP4 (ATL-APrEST90977) |