Protein Description: UTP11, small subunit processome component homolog (S. cerevisiae)
Gene Name: UTP11
Alternative Gene Name: CGI-94
Sequence: HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
Interspecies mouse/rat: ENSMUSG00000028907: 93%, ENSRNOG00000007174: 93%
Entrez Gene ID: 51118
Uniprot ID: Q9Y3A2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UTP11
Alternative Gene Name: CGI-94
Sequence: HIIKETKEEVTPEQLKLMRTQDVKYIEMKRVAEAKKIERLKSELHLLDFQGKQQNKHVFFFDTKKEVEQFDVATHLQTAPEL
Interspecies mouse/rat: ENSMUSG00000028907: 93%, ENSRNOG00000007174: 93%
Entrez Gene ID: 51118
Uniprot ID: Q9Y3A2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen UTP11 (ATL-APrEST77129) | |
| Antibody | Anti UTP11 pAb (ATL-HPA045830) |
| Documents & Links for PrEST Antigen UTP11 (ATL-APrEST77129) | |
| Datasheet | PrEST Antigen UTP11 (ATL-APrEST77129) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UTP11 (ATL-APrEST77129) at Atlas |
| Documents & Links for PrEST Antigen UTP11 (ATL-APrEST77129) | |
| Datasheet | PrEST Antigen UTP11 (ATL-APrEST77129) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UTP11 (ATL-APrEST77129) |