Protein Description: ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
Gene Name: UQCRFS1
Alternative Gene Name: RIP1, RIS1, RISP, UQCR5
Sequence: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL
Interspecies mouse/rat: ENSMUSG00000038462: 91%, ENSRNOG00000018281: 91%
Entrez Gene ID: 7386
Uniprot ID: P47985
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UQCRFS1
Alternative Gene Name: RIP1, RIS1, RISP, UQCR5
Sequence: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL
Interspecies mouse/rat: ENSMUSG00000038462: 91%, ENSRNOG00000018281: 91%
Entrez Gene ID: 7386
Uniprot ID: P47985
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen UQCRFS1 (ATL-APrEST87554) | |
| Antibody | Anti UQCRFS1 pAb (ATL-HPA050339 w/enhanced validation) |
| Documents & Links for PrEST Antigen UQCRFS1 (ATL-APrEST87554) | |
| Datasheet | PrEST Antigen UQCRFS1 (ATL-APrEST87554) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UQCRFS1 (ATL-APrEST87554) at Atlas |
| Documents & Links for PrEST Antigen UQCRFS1 (ATL-APrEST87554) | |
| Datasheet | PrEST Antigen UQCRFS1 (ATL-APrEST87554) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UQCRFS1 (ATL-APrEST87554) |