Protein Description: uridine phosphorylase 1
Gene Name: UPP1
Alternative Gene Name: UDRPASE, UP, UPASE, UPP
Sequence: TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP
Interspecies mouse/rat: ENSMUSG00000020407: 64%, ENSRNOG00000004972: 63%
Entrez Gene ID: 7378
Uniprot ID: Q16831
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UPP1
Alternative Gene Name: UDRPASE, UP, UPASE, UPP
Sequence: TGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFP
Interspecies mouse/rat: ENSMUSG00000020407: 64%, ENSRNOG00000004972: 63%
Entrez Gene ID: 7378
Uniprot ID: Q16831
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen UPP1 (ATL-APrEST85815) | |
| Antibody | Anti UPP1 pAb (ATL-HPA055394 w/enhanced validation) |
| Documents & Links for PrEST Antigen UPP1 (ATL-APrEST85815) | |
| Datasheet | PrEST Antigen UPP1 (ATL-APrEST85815) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UPP1 (ATL-APrEST85815) at Atlas |
| Documents & Links for PrEST Antigen UPP1 (ATL-APrEST85815) | |
| Datasheet | PrEST Antigen UPP1 (ATL-APrEST85815) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UPP1 (ATL-APrEST85815) |