PrEST Antigen UNG (ATL-APrEST95642)

Catalog No:
ATL-APrEST95642-100
$345.00

Description

Product Description

PrEST Antigen UNG, Gene description: uracil DNA glycosylase, Alternative Gene Names: DGU, HIGM4, UDG, UNG1, UNG2, Antigen sequence: GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGL
Gene ID - Mouse ENSMUSG00000029591
Gene ID - Rat ENSRNOG00000000692
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen UNG (ATL-APrEST95642)
Vendor Page PrEST Antigen UNG (ATL-APrEST95642) at Atlas Antibodies

Documents & Links for PrEST Antigen UNG (ATL-APrEST95642)
Vendor Page PrEST Antigen UNG (ATL-APrEST95642)

Product Description

PrEST Antigen UNG, Gene description: uracil DNA glycosylase, Alternative Gene Names: DGU, HIGM4, UDG, UNG1, UNG2, Antigen sequence: GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence GESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGL
Gene ID - Mouse ENSMUSG00000029591
Gene ID - Rat ENSRNOG00000000692
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen UNG (ATL-APrEST95642)
Vendor Page PrEST Antigen UNG (ATL-APrEST95642) at Atlas Antibodies

Documents & Links for PrEST Antigen UNG (ATL-APrEST95642)
Vendor Page PrEST Antigen UNG (ATL-APrEST95642)