Protein Description: ubiquitin C
Gene Name: UBC
Alternative Gene Name: FLJ25987, MGC8385
Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
Interspecies mouse/rat: ENSMUSG00000103034: 100%, ENSRNOG00000057823: 100%
Entrez Gene ID: 7316
Uniprot ID: P0CG48
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: UBC
Alternative Gene Name: FLJ25987, MGC8385
Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ
Interspecies mouse/rat: ENSMUSG00000103034: 100%, ENSRNOG00000057823: 100%
Entrez Gene ID: 7316
Uniprot ID: P0CG48
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen UBC (ATL-APrEST88959) | |
| Antibody | Anti UBC pAb (ATL-HPA041344) |
| Documents & Links for PrEST Antigen UBC (ATL-APrEST88959) | |
| Datasheet | PrEST Antigen UBC (ATL-APrEST88959) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBC (ATL-APrEST88959) at Atlas |
| Documents & Links for PrEST Antigen UBC (ATL-APrEST88959) | |
| Datasheet | PrEST Antigen UBC (ATL-APrEST88959) Datasheet (External Link) |
| Vendor Page | PrEST Antigen UBC (ATL-APrEST88959) |