Protein Description: transmembrane protease, serine 11E
Gene Name: TMPRSS11E
Alternative Gene Name: DESC1, TMPRSS11E2
Sequence: VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP
Interspecies mouse/rat: ENSMUSG00000054537: 75%, ENSRNOG00000022255: 74%
Entrez Gene ID: 28983
Uniprot ID: Q9UL52
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: TMPRSS11E
Alternative Gene Name: DESC1, TMPRSS11E2
Sequence: VLAHMLLICRFHSTEDPETVDKIVQLVLHEKLQDAVGPPKVDPHSVKIKKINKTETDSYLNHCCGTRRSKTLGQSLRIVGGTEVEEGEWP
Interspecies mouse/rat: ENSMUSG00000054537: 75%, ENSRNOG00000022255: 74%
Entrez Gene ID: 28983
Uniprot ID: Q9UL52
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen TMPRSS11E (ATL-APrEST83233) | |
| Antibody | Anti TMPRSS11E pAb (ATL-HPA051062) |
| Documents & Links for PrEST Antigen TMPRSS11E (ATL-APrEST83233) | |
| Datasheet | PrEST Antigen TMPRSS11E (ATL-APrEST83233) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS11E (ATL-APrEST83233) at Atlas |
| Documents & Links for PrEST Antigen TMPRSS11E (ATL-APrEST83233) | |
| Datasheet | PrEST Antigen TMPRSS11E (ATL-APrEST83233) Datasheet (External Link) |
| Vendor Page | PrEST Antigen TMPRSS11E (ATL-APrEST83233) |