Protein Description: transmembrane protein 106C
Gene Name: TMEM106C
Alternative Gene Name: MGC5576
Sequence: SVKISYIGLMTQSSLETHHYVDCGGNSTAI
Interspecies mouse/rat: ENSMUSG00000052369: 77%, ENSRNOG00000053269: 67%
Entrez Gene ID: 79022
Uniprot ID: Q9BVX2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: TMEM106C
Alternative Gene Name: MGC5576
Sequence: SVKISYIGLMTQSSLETHHYVDCGGNSTAI
Interspecies mouse/rat: ENSMUSG00000052369: 77%, ENSRNOG00000053269: 67%
Entrez Gene ID: 79022
Uniprot ID: Q9BVX2
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen TMEM106C (ATL-APrEST72876) | |
Antibody | Anti TMEM106C pAb (ATL-HPA047204 w/enhanced validation) |
Documents & Links for PrEST Antigen TMEM106C (ATL-APrEST72876) | |
Datasheet | PrEST Antigen TMEM106C (ATL-APrEST72876) Datasheet (External Link) |
Vendor Page | PrEST Antigen TMEM106C (ATL-APrEST72876) at Atlas |
Documents & Links for PrEST Antigen TMEM106C (ATL-APrEST72876) | |
Datasheet | PrEST Antigen TMEM106C (ATL-APrEST72876) Datasheet (External Link) |
Vendor Page | PrEST Antigen TMEM106C (ATL-APrEST72876) |