PrEST Antigen TIMM22 (ATL-APrEST86874)

Catalog No:
ATL-APrEST86874-100
$290.00
Protein Description: translocase of inner mitochondrial membrane 22 homolog (yeast)
Gene Name: TIMM22
Alternative Gene Name: TEX4
Sequence: GIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKA
Interspecies mouse/rat: ENSMUSG00000020843: 96%, ENSRNOG00000007988: 95%
Entrez Gene ID: 29928
Uniprot ID: Q9Y584
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Cognate Antibody/Antigen for PrEST Antigen TIMM22 (ATL-APrEST86874)
Antibody Anti TIMM22 pAb (ATL-HPA045138 w/enhanced validation)
Documents & Links for PrEST Antigen TIMM22 (ATL-APrEST86874)
Datasheet PrEST Antigen TIMM22 (ATL-APrEST86874) Datasheet (External Link)
Vendor Page PrEST Antigen TIMM22 (ATL-APrEST86874) at Atlas

Documents & Links for PrEST Antigen TIMM22 (ATL-APrEST86874)
Datasheet PrEST Antigen TIMM22 (ATL-APrEST86874) Datasheet (External Link)
Vendor Page PrEST Antigen TIMM22 (ATL-APrEST86874)