Protein Description: suppression of tumorigenicity 5
Gene Name: ST5
Alternative Gene Name: DENND2B, HTS1, p126
Sequence: PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK
Interspecies mouse/rat: ENSMUSG00000031024: 94%, ENSRNOG00000013934: 65%
Entrez Gene ID: 6764
Uniprot ID: P78524
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ST5
Alternative Gene Name: DENND2B, HTS1, p126
Sequence: PSSPTENGTENQPKFGSKSTLEENAYEDIVGDLPKENPYEDVDLKSRRAGRKSQQLSENSLDSLHRMWSPQDRKYNSPPTQLSLKPNSQSLRSGNWSERK
Interspecies mouse/rat: ENSMUSG00000031024: 94%, ENSRNOG00000013934: 65%
Entrez Gene ID: 6764
Uniprot ID: P78524
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ST5 (ATL-APrEST80692) | |
| Antibody | Anti ST5 pAb (ATL-HPA046796) |
| Documents & Links for PrEST Antigen ST5 (ATL-APrEST80692) | |
| Datasheet | PrEST Antigen ST5 (ATL-APrEST80692) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ST5 (ATL-APrEST80692) at Atlas |
| Documents & Links for PrEST Antigen ST5 (ATL-APrEST80692) | |
| Datasheet | PrEST Antigen ST5 (ATL-APrEST80692) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ST5 (ATL-APrEST80692) |