Protein Description: suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
Gene Name: ST13
Alternative Gene Name: FAM10A1, HIP, HSPABP1, P48, SNC6
Sequence: PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA
Interspecies mouse/rat: ENSMUSG00000022403: 95%, ENSRNOG00000019070: 94%
Entrez Gene ID: 6767
Uniprot ID: P50502
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ST13
Alternative Gene Name: FAM10A1, HIP, HSPABP1, P48, SNC6
Sequence: PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA
Interspecies mouse/rat: ENSMUSG00000022403: 95%, ENSRNOG00000019070: 94%
Entrez Gene ID: 6767
Uniprot ID: P50502
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ST13 (ATL-APrEST83231) | |
| Antibody | Anti ST13 pAb (ATL-HPA046412 w/enhanced validation) |
| Documents & Links for PrEST Antigen ST13 (ATL-APrEST83231) | |
| Datasheet | PrEST Antigen ST13 (ATL-APrEST83231) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ST13 (ATL-APrEST83231) at Atlas |
| Documents & Links for PrEST Antigen ST13 (ATL-APrEST83231) | |
| Datasheet | PrEST Antigen ST13 (ATL-APrEST83231) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ST13 (ATL-APrEST83231) |