Protein Description: sperm acrosome associated 5B
Gene Name: SPACA5B
Alternative Gene Name: dJ54B20.3, LYC5, LYZL5, PNPK6288, SLLP2, UNQ6288
Sequence: AGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLC
Interspecies mouse/rat: ENSMUSG00000037167: 89%, ENSRNOG00000045622: 90%
Entrez Gene ID: 729201
Uniprot ID: Q96QH8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: SPACA5B
Alternative Gene Name: dJ54B20.3, LYC5, LYZL5, PNPK6288, SLLP2, UNQ6288
Sequence: AGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLC
Interspecies mouse/rat: ENSMUSG00000037167: 89%, ENSRNOG00000045622: 90%
Entrez Gene ID: 729201
Uniprot ID: Q96QH8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen SPACA5B (ATL-APrEST89014) | |
| Antibody | Anti SPACA5B pAb (ATL-HPA044747) |
| Documents & Links for PrEST Antigen SPACA5B (ATL-APrEST89014) | |
| Datasheet | PrEST Antigen SPACA5B (ATL-APrEST89014) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SPACA5B (ATL-APrEST89014) at Atlas |
| Documents & Links for PrEST Antigen SPACA5B (ATL-APrEST89014) | |
| Datasheet | PrEST Antigen SPACA5B (ATL-APrEST89014) Datasheet (External Link) |
| Vendor Page | PrEST Antigen SPACA5B (ATL-APrEST89014) |