PrEST Antigen SORCS2 (ATL-APrEST95790)

Catalog No:
ATL-APrEST95790-100
$345.00

Description

Product Description

PrEST Antigen SORCS2, Gene description: sortilin related VPS10 domain containing receptor 2, Alternative Gene Names: KIAA1329, Antigen sequence: PSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence PSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHT
Gene ID - Mouse ENSMUSG00000029093
Gene ID - Rat ENSRNOG00000007033
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen SORCS2 (ATL-APrEST95790)
Vendor Page PrEST Antigen SORCS2 (ATL-APrEST95790) at Atlas Antibodies

Documents & Links for PrEST Antigen SORCS2 (ATL-APrEST95790)
Vendor Page PrEST Antigen SORCS2 (ATL-APrEST95790)

Product Description

PrEST Antigen SORCS2, Gene description: sortilin related VPS10 domain containing receptor 2, Alternative Gene Names: KIAA1329, Antigen sequence: PSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence PSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHT
Gene ID - Mouse ENSMUSG00000029093
Gene ID - Rat ENSRNOG00000007033
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen SORCS2 (ATL-APrEST95790)
Vendor Page PrEST Antigen SORCS2 (ATL-APrEST95790) at Atlas Antibodies

Documents & Links for PrEST Antigen SORCS2 (ATL-APrEST95790)
Vendor Page PrEST Antigen SORCS2 (ATL-APrEST95790)