Protein Description: solute carrier family 35, member B1
Gene Name: SLC35B1
Alternative Gene Name: UGTREL1
Sequence: QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
Interspecies mouse/rat: ENSMUSG00000020873: 100%, ENSRNOG00000004510: 100%
Entrez Gene ID: 10237
Uniprot ID: P78383
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: SLC35B1
Alternative Gene Name: UGTREL1
Sequence: QFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYP
Interspecies mouse/rat: ENSMUSG00000020873: 100%, ENSRNOG00000004510: 100%
Entrez Gene ID: 10237
Uniprot ID: P78383
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Cognate Antibody/Antigen for PrEST Antigen SLC35B1 (ATL-APrEST83996) | |
Antibody | Anti SLC35B1 pAb (ATL-HPA048655) |
Antibody | Anti SLC35B1 pAb (ATL-HPA057418) |
Documents & Links for PrEST Antigen SLC35B1 (ATL-APrEST83996) | |
Datasheet | PrEST Antigen SLC35B1 (ATL-APrEST83996) Datasheet (External Link) |
Vendor Page | PrEST Antigen SLC35B1 (ATL-APrEST83996) at Atlas |
Documents & Links for PrEST Antigen SLC35B1 (ATL-APrEST83996) | |
Datasheet | PrEST Antigen SLC35B1 (ATL-APrEST83996) Datasheet (External Link) |
Vendor Page | PrEST Antigen SLC35B1 (ATL-APrEST83996) |