Protein Description: ribosomal protein S25
Gene Name: RPS25
Alternative Gene Name: S25
Sequence: KDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKE
Interspecies mouse/rat: ENSMUSG00000009927: 100%, ENSRNOG00000027503: 100%
Entrez Gene ID: 6230
Uniprot ID: P62851
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RPS25
Alternative Gene Name: S25
Sequence: KDDKKKKDAGKSAKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKE
Interspecies mouse/rat: ENSMUSG00000009927: 100%, ENSRNOG00000027503: 100%
Entrez Gene ID: 6230
Uniprot ID: P62851
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen RPS25 (ATL-APrEST95518) | |
| Antibody | Anti RPS25 pAb (ATL-HPA078683) |
| Documents & Links for PrEST Antigen RPS25 (ATL-APrEST95518) | |
| Datasheet | PrEST Antigen RPS25 (ATL-APrEST95518) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RPS25 (ATL-APrEST95518) at Atlas |
| Documents & Links for PrEST Antigen RPS25 (ATL-APrEST95518) | |
| Datasheet | PrEST Antigen RPS25 (ATL-APrEST95518) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RPS25 (ATL-APrEST95518) |