Protein Description: rhophilin associated tail protein 1B
Gene Name: ROPN1B
Alternative Gene Name:
Sequence: QDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL
Interspecies mouse/rat: ENSMUSG00000022832: 76%, ENSRNOG00000002187: 78%
Entrez Gene ID: 152015
Uniprot ID: Q9BZX4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: ROPN1B
Alternative Gene Name:
Sequence: QDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKIL
Interspecies mouse/rat: ENSMUSG00000022832: 76%, ENSRNOG00000002187: 78%
Entrez Gene ID: 152015
Uniprot ID: Q9BZX4
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen ROPN1B (ATL-APrEST82634) | |
| Antibody | Anti ROPN1B pAb (ATL-HPA052530) |
| Documents & Links for PrEST Antigen ROPN1B (ATL-APrEST82634) | |
| Datasheet | PrEST Antigen ROPN1B (ATL-APrEST82634) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ROPN1B (ATL-APrEST82634) at Atlas |
| Documents & Links for PrEST Antigen ROPN1B (ATL-APrEST82634) | |
| Datasheet | PrEST Antigen ROPN1B (ATL-APrEST82634) Datasheet (External Link) |
| Vendor Page | PrEST Antigen ROPN1B (ATL-APrEST82634) |