PrEST Antigen RBM46 (ATL-APrEST95630)

Catalog No:
ATL-APrEST95630-100
$345.00

Description

Product Description

PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Antigen sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ
Gene ID - Mouse ENSMUSG00000033882
Gene ID - Rat ENSRNOG00000025823
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen RBM46 (ATL-APrEST95630)
Vendor Page PrEST Antigen RBM46 (ATL-APrEST95630) at Atlas Antibodies

Documents & Links for PrEST Antigen RBM46 (ATL-APrEST95630)
Vendor Page PrEST Antigen RBM46 (ATL-APrEST95630)

Product Description

PrEST Antigen RBM46, Gene description: RNA binding motif protein 46, Alternative Gene Names: CT68, MGC27016, Antigen sequence: QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence QFTLLHLDYNFHRSSINSLSPVSATLSSGTPSVLPYTSRPYSYPGYPLSPTISLANGSHVGQRLCISNQ
Gene ID - Mouse ENSMUSG00000033882
Gene ID - Rat ENSRNOG00000025823
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen RBM46 (ATL-APrEST95630)
Vendor Page PrEST Antigen RBM46 (ATL-APrEST95630) at Atlas Antibodies

Documents & Links for PrEST Antigen RBM46 (ATL-APrEST95630)
Vendor Page PrEST Antigen RBM46 (ATL-APrEST95630)