Protein Description: RAB19, member RAS oncogene family
Gene Name: RAB19
Alternative Gene Name: RAB19B
Sequence: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
Interspecies mouse/rat: ENSMUSG00000029923: 95%, ENSRNOG00000009030: 97%
Entrez Gene ID: 401409
Uniprot ID: A4D1S5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: RAB19
Alternative Gene Name: RAB19B
Sequence: LIGNKCDLWEKRHVLFEDACTLAEKYGLLAVLETSAKES
Interspecies mouse/rat: ENSMUSG00000029923: 95%, ENSRNOG00000009030: 97%
Entrez Gene ID: 401409
Uniprot ID: A4D1S5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen RAB19 (ATL-APrEST85096) | |
| Antibody | Anti RAB19 pAb (ATL-HPA051077) |
| Documents & Links for PrEST Antigen RAB19 (ATL-APrEST85096) | |
| Datasheet | PrEST Antigen RAB19 (ATL-APrEST85096) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB19 (ATL-APrEST85096) at Atlas |
| Documents & Links for PrEST Antigen RAB19 (ATL-APrEST85096) | |
| Datasheet | PrEST Antigen RAB19 (ATL-APrEST85096) Datasheet (External Link) |
| Vendor Page | PrEST Antigen RAB19 (ATL-APrEST85096) |