Protein Description: purine-rich element binding protein G
Gene Name: PURG
Alternative Gene Name: PURG-A, PURG-B
Sequence: RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
Interspecies mouse/rat: ENSMUSG00000049184: 90%, ENSRNOG00000015426: 92%
Entrez Gene ID: 29942
Uniprot ID: Q9UJV8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PURG
Alternative Gene Name: PURG-A, PURG-B
Sequence: RGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASK
Interspecies mouse/rat: ENSMUSG00000049184: 90%, ENSRNOG00000015426: 92%
Entrez Gene ID: 29942
Uniprot ID: Q9UJV8
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PURG (ATL-APrEST84133) | |
| Antibody | Anti PURG pAb (ATL-HPA047746) |
| Documents & Links for PrEST Antigen PURG (ATL-APrEST84133) | |
| Datasheet | PrEST Antigen PURG (ATL-APrEST84133) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PURG (ATL-APrEST84133) at Atlas |
| Documents & Links for PrEST Antigen PURG (ATL-APrEST84133) | |
| Datasheet | PrEST Antigen PURG (ATL-APrEST84133) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PURG (ATL-APrEST84133) |