Description
Product Description
PrEST Antigen PRUNE2, Gene description: prune homolog 2 with BCH domain, Alternative Gene Names: A214N16.3, bA214N16.3, BMCC1, BNIPXL, C9orf65, KIAA0367, Antigen sequence: AFDHSFSDASGLNTSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPLEEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications
| Product Specifications | |
| Gene Sequence | AFDHSFSDASGLNTSTGTIDDMSKLTLSEGHPETPVDGDLGKQDICSSEASWGDFEYDVMGQNIDEDLLREPEHFLYGGDPPLEEDSLKQSLAPYTPPFDLSYLTEPAQSAETIEEAGSPEDESLGCRAAEIVLSALPDR |
| Gene ID - Mouse | ENSMUSG00000039126 |
| Gene ID - Rat | ENSRNOG00000014664 |
| Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links
| Documents & Links for PrEST Antigen PRUNE2 (ATL-APrEST96130) | |
| Vendor Page | PrEST Antigen PRUNE2 (ATL-APrEST96130) at Atlas Antibodies |
| Documents & Links for PrEST Antigen PRUNE2 (ATL-APrEST96130) | |
| Vendor Page | PrEST Antigen PRUNE2 (ATL-APrEST96130) |