PrEST Antigen PPP3CC (ATL-APrEST95711)

Catalog No:
ATL-APrEST95711-100
$345.00

Description

Product Description

PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN
Gene ID - Mouse ENSMUSG00000021816
Gene ID - Rat ENSRNOG00000009745
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen PPP3CC (ATL-APrEST95711)
Vendor Page PrEST Antigen PPP3CC (ATL-APrEST95711) at Atlas Antibodies

Documents & Links for PrEST Antigen PPP3CC (ATL-APrEST95711)
Vendor Page PrEST Antigen PPP3CC (ATL-APrEST95711)

Product Description

PrEST Antigen PPP3CC, Gene description: protein phosphatase 3 catalytic subunit gamma, Alternative Gene Names: CALNA3, PP2Bgamma, Antigen sequence: RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.

Product Specifications

Product Specifications
Gene Sequence RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN
Gene ID - Mouse ENSMUSG00000021816
Gene ID - Rat ENSRNOG00000009745
Buffer PBS and 1M Urea, pH 7.4.

Documents & Links

Documents & Links for PrEST Antigen PPP3CC (ATL-APrEST95711)
Vendor Page PrEST Antigen PPP3CC (ATL-APrEST95711) at Atlas Antibodies

Documents & Links for PrEST Antigen PPP3CC (ATL-APrEST95711)
Vendor Page PrEST Antigen PPP3CC (ATL-APrEST95711)