Protein Description: phosphatidylinositol glycan anchor biosynthesis, class M
Gene Name: PIGM
Alternative Gene Name: GPI-MT-I
Sequence: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
Interspecies mouse/rat: ENSMUSG00000050229: 95%, ENSRNOG00000060604: 95%
Entrez Gene ID: 93183
Uniprot ID: Q9H3S5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PIGM
Alternative Gene Name: GPI-MT-I
Sequence: QDRTLHVRYTDIDYQVFTDAARFVTEGRSPYLRATYRYT
Interspecies mouse/rat: ENSMUSG00000050229: 95%, ENSRNOG00000060604: 95%
Entrez Gene ID: 93183
Uniprot ID: Q9H3S5
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Cognate Antibody/Antigen for PrEST Antigen PIGM (ATL-APrEST83568) | |
| Antibody | Anti PIGM pAb (ATL-HPA047418) |
| Documents & Links for PrEST Antigen PIGM (ATL-APrEST83568) | |
| Datasheet | PrEST Antigen PIGM (ATL-APrEST83568) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PIGM (ATL-APrEST83568) at Atlas |
| Documents & Links for PrEST Antigen PIGM (ATL-APrEST83568) | |
| Datasheet | PrEST Antigen PIGM (ATL-APrEST83568) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PIGM (ATL-APrEST83568) |