Description
Product Description
PrEST Antigen PIAS2, Gene description: protein inhibitor of activated STAT 2, Alternative Gene Names: ARIP3, miz, PIASX-ALPHA, PIASX-BETA, ZMIZ4, Antigen sequence: MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Product Specifications
| Product Specifications | |
| Gene Sequence | MRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVI |
| Gene ID - Mouse | ENSMUSG00000025423 |
| Gene ID - Rat | ENSRNOG00000017493 |
| Buffer | PBS and 1M Urea, pH 7.4. |
Documents & Links
| Documents & Links for PrEST Antigen PIAS2 (ATL-APrEST96036) | |
| Vendor Page | PrEST Antigen PIAS2 (ATL-APrEST96036) at Atlas Antibodies |
| Documents & Links for PrEST Antigen PIAS2 (ATL-APrEST96036) | |
| Vendor Page | PrEST Antigen PIAS2 (ATL-APrEST96036) |