Protein Description: phosphoglycolate phosphatase
Gene Name: PGP
Alternative Gene Name:
Sequence: DTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSI
Interspecies mouse/rat: ENSMUSG00000043445: 86%, ENSRNOG00000009536: 86%
Entrez Gene ID: 283871
Uniprot ID: A6NDG6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
Gene Name: PGP
Alternative Gene Name:
Sequence: DTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSI
Interspecies mouse/rat: ENSMUSG00000043445: 86%, ENSRNOG00000009536: 86%
Entrez Gene ID: 283871
Uniprot ID: A6NDG6
Buffer: PBS and 1M Urea, pH 7.4.
Storage Temperature: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles.
| Documents & Links for PrEST Antigen PGP (ATL-APrEST82345) | |
| Datasheet | PrEST Antigen PGP (ATL-APrEST82345) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PGP (ATL-APrEST82345) at Atlas |
| Documents & Links for PrEST Antigen PGP (ATL-APrEST82345) | |
| Datasheet | PrEST Antigen PGP (ATL-APrEST82345) Datasheet (External Link) |
| Vendor Page | PrEST Antigen PGP (ATL-APrEST82345) |